Loading...
Search Results for: Operation of sports and leisure facilities
Found 13336 companiessupplyautonomy.com/curemedspa.us
WE ARE THE #1 NON-INVASIVE COSMETIC MEDICAL PRACTICE AND WELLNESS CENTER IN MYSTIC, CT.
Our priority is to create an experience for your body, mind, and spirit, with a results-driven treatment plan... Read More »
- Spa services
- Mystic
- United States
supplyautonomy.com/gettinlippywithbritaesthetics.us
Gettin Lippy With Brit Aesthetics is passionate about helping patients be their best selves by enhancing their natural beauty and slowing down the clock with botox-neurotoxin, Dysport, Xeomin,... Read More »
- Spa services
- Fort Worth
- United States
supplyautonomy.com/aesthetify.us
At Aesthetify, we're dedicated to providing medical care that's as unique as you are. We recognize that each person is a unique canvas, shaped by their history, lifestyle, and aspirations.... Read More »
- Spa services
- Watchung
- United States
supplyautonomy.com/quiktox.us
Welcome to QUIKTOX™ Injection Studio, where we revolutionize the way Tox treatments are delivered. Founded and funded by industry veterans, our clinic is built upon a foundation of deep domain m... Read More »
- Spa services
- Costa Mesa
- United States
supplyautonomy.com/foreveryoungmedispasugarlandtx.us
Forever Young Medi Spa is your one-stop Medical Spa for all your beauty and wellness needs. Our team of licensed professionals is dedicated to helping you look and feel your best, using only the most... Read More »
- Spa services
- Sugar Land
- United States
supplyautonomy.com/allureaesthetics.us
At Allure, we like to understand your beauty & aesthetic goals so we can guide you to the right services and products. We offer monthly specials which are shared on both social media & on our... Read More »
- Spa services
- Great Falls
- United States
supplyautonomy.com/dolcevidamedicalsparidgefield.us
Dolce Vida Med Spa is a full-service medical aesthetics resource serving men and women from in and around Greenwich, Westport, Ridgefield, Trumbull, and Hamden, Connecticut. Under the leadership of... Read More »
- Spa services
- Ridgefield
- United States
supplyautonomy.com/inglofaceandbodysculpting.us
At IN•GLO™ Face and Body Sculpting Med Spa we have certainly done our best to perfect them. Dedicating ourselves to the craft, we maintain the knowledge necessary to demonstrate our services to those ... Read More »
- Spa services
- New York
- United States
supplyautonomy.com/rajeunirmedical.us
At Rajeunir Medical, Seattle's premier aesthetics & wellness center & med spa, Dr. Mona Shawky's expertise for personalized, concierge-level care prioritizes your health and... Read More »
- Spa services
- Mercer Island
- United States
supplyautonomy.com/austexwellnessandmedicalspa2.us
AUSTEX is a top Medical Spa in Austin, TX. We service all of Austin including, Lakeway, Bee Cave, Spicewood, Four Points, Westlake, and Dripping Springs. We are one of the only Medical Spas to offer... Read More »
- Spa services
- Lakeway
- United States
supplyautonomy.com/pausepainwellness3a.us
Mississippi's #1 Medical Card Referral Clinic with multiple statewide locations to serve you.
We do more than get you approved for your medical cannabis card. Pause Pain & Wellness is... Read More »
- Medical treatment
- Olive Branch
- United States
supplyautonomy.com/priveosanté.ca
Priveo Santé was born out of a vision to create a welcoming, comfortable and warm environment for everyone who walks through our doors. We are aware that your health is a priority, which is why we ... Read More »
- Medical treatment
- Laval
- Canada
supplyautonomy.com/upliftaesthetics.us
Let us help you feel like you again! We offer Botox, Filler, and skin care solutions to help you regain your sense of self, increase self confidence, and enhance or restore your natural beauty.... Read More »
- Spa services
- Oakdale
- United States
supplyautonomy.com/puredayspa.ca
We are a full service spa located in beautiful Mattick's Farm. Our staff of friendly and licensed estheticians cover all your spa needs. Our treatments include facials for all skin types,... Read More »
- Spa services
- Victoria
- Canada
supplyautonomy.com/signatureaestheticsivlounge.us
Our practitioners are board certified and proficient at the art of facial rejuvenation. Our services include injectables such as Botox and Dysport, Dermal Fillers, Micro-needling, Chemical Peels, and... Read More »
- Spa services
- Liberty Hill
- United States
supplyautonomy.com/colorectalclinicofmichigan1.us
Dr. Alame is board certified in general surgery and specializes in advanced colorectal surgical procedures. He earned his medical degree from the prestigious University of Miami in Florida. After... Read More »
- Medical treatment
- Saint Clair Shores
- United States
supplyautonomy.com/drsharonaesthetics.us
Dr. Sharon Aesthetics Medical Spa offers a wide variety of beauty enhancing procedures such as neurotoxins, dermal fillers, microneedling, Vampire facials/facelifts, “O” shot, “P” shot, hair restora... Read More »
- Spa services
- Houston
- United States
supplyautonomy.com/elevatemedandaesthetics.us
Elevate Medical and Aesthetic Spa is a place to be for all you aesthetic needs. We provide complete medical and wellness care in a peaceful environment that combines services offered in spa with... Read More »
- Spa services
- Plantation
- United States
supplyautonomy.com/adoromedicalspa1.us
Over the years, Dr. Pacheco has established a practice that takes pride in first-rate care, comprehensive rejuvenation, and in the satisfaction and comfort of it's patients. Dr. Pacheco's... Read More »
- Spa services
- Severna Park
- United States
supplyautonomy.com/bluedivine.us
Blue Divine is an Atlanta med spa focusing on all skin tones with dual wavelength YAG & Alexandrite laser hair removal, & Aerolase YAG laser facials, Cynosure signature laser facials, medical... Read More »
- Spa services
- Atlanta
- United States
supplyautonomy.com/vivantaestheticswellness.us
We believe that everyone is naturally beautiful and unique, but we also understand that most people have insecurities that can hold them back in their life. Our purpose is to enhance your natural... Read More »
- Spa services
- Itasca
- United States
supplyautonomy.com/afcurgentcaresouthcharlotte.us
Urgent Care South Charlotte. Located On the North Corner of Johnston Road Plaza, in front of Food Lion Grocery Store. AFC Urgent Care treats everything from cuts and bruises to fractures and colds... Read More »
- Medical treatment | Medical care for patients
- Charlotte
- United States
supplyautonomy.com/veritareset.mx
Verita Reset is an integrative medical treatment center in Tijuana, Mexico specializing in the holistic treatment of chronic Lyme Disease, rheumatoid arthritis, lupus, mold toxicity, and other... Read More »
- Medical treatment
- Tijuana
- Mexico
supplyautonomy.com/macleyfamilypracticeandwalkinclinic.us
Whether it is a minor sprain, fever, ear pain, or a complex medical problem, we are here for you. Our friendly and competent staff, including board-certified physicians, utilizes the latest medical... Read More »
- Clinic | Medical treatment | Doctor consultations | Doctors
- Duluth
- United States
supplyautonomy.com/texasveinexperts.us
Our team at Frisco consists of highly trained vascular specialists that diagnose and treat venous diseases including venous reflux using minimally-invasive techniques for more than 10 years. Take the... Read More »
- Medical treatment
- Frisco
- United States
supplyautonomy.com/dankrevolutionstore11.nl
Dank Revolution store provides visitors with reviews of the best medical cannabis strains.
Explore the latest cannabis news, Dank Revolution store tips, education and more from Dank Revolution... Read More »
- Medical treatment
- Capelle aan den IJssel
- Netherlands
supplyautonomy.com/hermannaestheticswellness.us
Hermann Wellness offers a wide variety of spa services that include facials, peels, microdermabrasion treatments. A facial is a great way to take care of your skin, especially when coupled with a... Read More »
- Medical treatment
- St. Petersburg
- United States
supplyautonomy.com/globalmedicalcare.gb
For the past 5 years, Global Medical Care has been providing affordable high-standard medical treatments for patients from Switzerland and Europe. The Firm’s reputation has been built on an u... Read More »
- Medical treatment
- South Wimbledon
- United Kingdom
supplyautonomy.com/nuhairmedical.ca
NuHair Medical offers state of the art surgical and non-surgical hair restoration for treatment of both female pattern baldness and male androgenic alopecia. Treatments offered include Follicular... Read More »
- Medical treatment
- Vancouver
- Canada
supplyautonomy.com/mdproactive.us
MDPROACTIVE is an online medical provider that aims to treat minor medical ailments for patients via the internet or smartphone, when they do not have convenient access to their primary care... Read More »
- Medical treatment
- Naperville
- United States