Search Results for: Packaging machines
Found 7631 companiesRelated categories
supplyautonomy.com/pentagonmarketing.in
Available in various dimensions, specifications, capacities, efficiency, etc, packaging machinery find applications in various industries like chemical, marine, food, etc. Pentagon Marketing is... Read More »
- Printers, photograph | Marker pens | Adhesives and tape | Packaging machinery
- Kochi
- India
supplyautonomy.com/taisunmachinery.tw
Tai sun machinery Co., ltd has been concentrating on the manufacture of the tissue paper converting machine since 1970. Now the "tai sun" brand has successfully exported
A big quantity of... Read More »
- Towel making machinery | Packaging machinery
- Taipei
- Taiwan
supplyautonomy.com/iterrainintlenterprisesco.tw
In the manufacture of those machines we use the most advanced modern techniques. We take pride in having offered the overseas markets products of unsurpassed quality and appearance for the 27 years.... Read More »
- Coffee beans, java | Other used machinery | Packaging machinery
- Taichung
- Taiwan
supplyautonomy.com/masaelimachinemanufacturing.ir
Masaeli Industry Machinery is a leading company is Iran`s packing industry founded in 1983.Our main products include pillow packing machines that are suitable for packing all of things in different... Read More »
- Packaging machinery | Packaging line
- Esfahan
- Iran
supplyautonomy.com/ptsancoindonesia.id
Sanco international based in Jakarta, Indonesia is a marketing arms company that owns an exclusive right to promote and to distribute end products from manufacturer of confectionery products in... Read More »
- Capsule filling machine | Packaging machinery
- Jakarta
- Indonesia
supplyautonomy.com/baodingjialifoodmachine.cn
Established in 1998, Baoding Jiali Food Machine Co.,ltd is a professional manufacturer engaged in research, development, production, sale and service of all kinds of food machines. Excellent... Read More »
- Food industry plant and equipment NES | Packaging machinery
- Baoding
- China
supplyautonomy.com/zhejiangruianyongxinmachineryfactory.cn
Ruian Yongxin Machinery Factory is located in Ruian, Zhejiang province, the famous City of Packaging Machinery in China. It always devotes itself to researching and developing packaging or... Read More »
- Other pharmaceutical machinery | Packaging machinery
- Ruian
- China
supplyautonomy.com/zhangjiagangkingstepmachineryco.cn
Our quality products are:
Pure/Mineral water production lines
Carbonated drink production lines;
Fruit juice production lines
Tea drink production lines
Soy milk and protein drink production... Read More »
- Pure water | Packaging machinery
- Suzhou
- China
supplyautonomy.com/nissionfoodmachinerycorporation.cn
Qingdao Nissin Food Machinery Co., Ltd. is a Sino-Japanese joint venture established in 1989. Our company applies complete Japanese technology, blueprints and components and works together with... Read More »
- Snack machinery | Packaging machinery
- Qingdao
- China
supplyautonomy.com/hbfpt.cn
Our company originates at the beginning of the 1990. Our predecessor is the Shijjiazhuang Changan Stainless Steel Plant, with the registered capital of 1,800,000 and a staff of 70 people.
Our... Read More »
- Food industry plant and equipment NES | Lift tables | Packaging machinery | Staples, wire
- Shijiazhuang
- China
supplyautonomy.com/guangzhouhaochiwoodworkingmachineryco.cn
Guangzhou JianChi Woodworking Machinery Co., Ltd. locates in ShaWan Town, Panyu Area, Guangzhou City. We have been insisting on the aim of "survive with quality and develop with... Read More »
- Packaging machinery | Woodworking equipment
- Guangzhou
- China
supplyautonomy.com/greatelectricsmachineco.cn
Since our establishment in 1989, Great-Electrics Machine Co., Ltd. has been the leading manufacturer in the thermoforming machine industry in China. We have a strong research and development team to... Read More »
- Welding equipment | Plastic welders | Packaging machinery | Egg trays
- Guangzhou
- China
supplyautonomy.com/jayengineeringcombine.in
Standard spares and machineries for soap, detergent, chemicals HVAC Plants
JAY ENGINEERING... Read More »
- Packaging machinery
- Ahmedabad
- India
supplyautonomy.com/bossengineeringcompany.in
Backed by industry experience of about a decade, we are engaged in manufacturing a completely automatic range of machines used in filling, capping, and labeling of bottles and containers. Our range... Read More »
- Packaging machinery | Pharmaceutical packaging machine | Other packaging materials
- Ahmedabad
- India
supplyautonomy.com/shreejipharmatech.in
About Us
Shreeji Pharmatech is one of the pioneering manufacturers of a wide range of Pharmaceutical Machineries like Dry Injectable Powder Filling Machine, Semi-automatic Dry Injectable Powder... Read More »
- Other textile machinery | Packaging machinery
- Ahmedabad
- India
supplyautonomy.com/masterfil.gb
The Adelphi Group of Companies has served customers all over the world for over 60 years. Our products range form simple stainless steel vessels to complete turnkey filling and capping lines, all... Read More »
- Packing and packaging - machinery and equipment | Drums, pails and barrels
- Aylesbury
- United Kingdom
supplyautonomy.com/susmatexmachinery.in
Dear Visitors and customers,
First of all, we would like to tell thanks to visitors and customers who visiting our website, so we are greatly pleased to introduce our company and our products to... Read More »
- Lace machines | Packaging machinery
- Ahmedabad
- India
supplyautonomy.com/omchamundaenterprises.in
A om chamunda enterprisesis one of the leading manufacturer, exporter and supplier of packaging machine from India. Designed for efficient operation to meet the varying requirements of different... Read More »
- Capsule filling machine | Packaging machinery
- Mumbai
- India
supplyautonomy.com/shrivinayakpackagingmachinepvt.in
Incorporated in the year 2000, Shri Vinayak Print-Pack is a leading importer and supplier of packaging machines. The range includes semi / fully automatic packaging machines, strapping machines,... Read More »
- Packaging machinery | Strapping
- New Delhi
- India
supplyautonomy.com/labhprojectspvt.in
Welcome to Labh Group!
Labh Group of Companies is a fast growing, well- recognized and an ISO 9001:2008 certified, Indian business group of global repute having presence in more than 100 countries... Read More »
- Rice bag | Packaging machinery | Strapping
- Ahmedabad
- India
supplyautonomy.com/rubyenterprise.in
Jaw crusher, complete crushing plant screening plant
- Well-drilling machinery | Used mining machinery | Packaging machinery
- Hooghly
- India
supplyautonomy.com/brintexsalescorporation.in
Unicon Exports and Imports, is an acknowledged manufacturer and supplier of Pharmaceutical machines for different pharmaceutical sections viz. Granulation section, Liquid Section, Ointment Section... Read More »
- Glass processing machinery | Capsule filling machine | Packaging machinery | Laboratory glassware & equipment
- New Delhi
- India
supplyautonomy.com/relianceenterprise.in
Offering a wide range of Food Processing & Bakery Equipments such as Tomato Ketchup machine, Single Door Deck Oven, Planetary mixer, Spiral mixer, Rotary rack Oven, Tray Dryer, Vacuum Bottle... Read More »
- Food industry plant and equipment NES | Machine tools for milling metal | Packaging machinery | Laboratory glassware &...
- Kolkata
- India
supplyautonomy.com/qingdaothinrawoodworkingmachineryfactory.cn
Our company is a professional company which is engaged in designing, manufacturing and selling woodworking machines. Since our establishment in 2009, we have got rapid development and a good... Read More »
- Leather production machinery | Cutting - machine tools | Packaging machinery | Woodworking equipment
- Qingdao
- China
supplyautonomy.com/problend.bg
We offer :
-constructing, manufacture, service and innovative production solutions for packaging equipment
-constructing, manufacture, service and innovation of non-standard equipment on... Read More »
- General mechanical components stock | Packing and packaging - machinery and equipment
- Shumen
- Bulgaria
supplyautonomy.com/hondonpackagingfoodmachinerygroup.cn
Paying attention to details, professional service, distinguished quality products and going the extra mile for our customers are the hallmark of Hondon. Supported by own manufacturing plants and... Read More »
- Packing and packaging - machinery and equipment | Packaging machinery
- Tianjin
- China
supplyautonomy.com/sarongspa.it
SARONG is a private company situated in Reggiolo (RE), in the north of Italy. Founded in 1972 when it brought onto the market the first automatic packaging machine for pharmaceutical suppositories... Read More »
- Packing and packaging - machinery and equipment | Packaging machinery
- Reggiolo
- Italy
supplyautonomy.com/dolzanimpiantisrl.it
Vertical packing machines, by weight / volume, with 4 welds, Doypack, vacuum, multi-track and semi-automatic for the food processing, pastry making, chemicals, pharmaceuticals and mechanical sectors.
- Packing and packaging - machinery and equipment | Food industry - machinery and equipment
- Galliera Veneta
- Italy
supplyautonomy.com/kansanmachineryco.tr
Kansan Machinery Company -today one of the major wet wipes, tissue napkins, toilet papers/towels machines and complete converting lines manufacturers- was established in 1992 as a small workshop. In... Read More »
- Capping and overcapping capsules, plastic | Packaging machinery | Hygiene and toilet products
- İzmir
- Turkey