Loading...
Search Results for: Recycling and recovery materials, services
Found 7483 companiesRelated categories
supplyautonomy.com/islandwidemarketingservicespvt.lk
Import & Supply of Industrial Chemicals,Machinery Lab Equipment,Packaging along with the Technological Inputs & Clearing & Forwarding Agents,Export of Coconut based... Read More »
- Recovery and regeneration of volatile organic compounds (VOC) | Protein purification services | Sieving of liquids for...
- Rajagiriya
- Sri Lanka
supplyautonomy.com/namoewastemanagement.in
We are an E-waste recycler based in Faridabad, with a PAN India presence. We offer customized services to our valuable customers for their e-waste disposal and compliance. As you may be aware that it... Read More »
- Recycling services for laser printer toner cartridges | Recycling services for information technology (IT) and...
- Faridabad
- India
supplyautonomy.com/texasrecycling.us
At Texas Recycling, we create customized sustainable solutions for companies that want to recycle responsibly—and affordably. We are a multi-commodity recycling facility in Dallas, Texas specializing ... Read More »
- Recycling services for laser printer toner cartridges | Recycling equipment
- Dallas
- United States
supplyautonomy.com/brightstarscrapmetal.au
We buy scrap metal in the best prices than anyone else. Good scrap metal trade will give you desirable financial
Gain and You will make a good profit by selling your scrap metals. We offer you the... Read More »
- Metal scrap collection and disposal | Scrap iron - salvaging and recycling
- Dandenong South
- Australia
supplyautonomy.com/recycleyourauto.ca
Recycle Your Auto is a cash for junk or scrap car removal and vehicle recycling service operating throughout Langley, Pitt Meadows, Maple Ridge, Mission, Surrey, Chilliwack, Aldergrove, Abbotsford,... Read More »
- Ferrous metal recovery services | Metals - recovery and recycling
- Aldergrove
- Canada
supplyautonomy.com/ekometalprodukt.hr
The company EKO METAL PRODUKT d.o.o. deals with the collection and recycling of metal waste in the territory of the Republic of Croatia.
It was created on the basis of 25 years of successful work... Read More »
- Metal scrap collection and disposal | Metal recycling | Ferrous metal recovery services | Metallurgy & ...
- Zagreb
- Croatia
supplyautonomy.com/junkantsedinburgh.gb
Skip Hire in Edinburgh
The Edinburgh Junk Ants team will come to your premises or home in our van. We remove rubbish and waste in our van which means you don't need to hire a skip and deal with... Read More »
- Litter collection services | Refuse collection services | Collection of hazardous waste | Hospital and laboratory waste...
- Edinburgh
- United Kingdom
supplyautonomy.com/absolutewasteclearance.gb
Skip Hire in Bristol
fully licensed household garden office hardcore warehouse etc.cleared and recycled fast efficient nohassle cheaper than skips
absolute waste clearance offer a rubbish removal... Read More »
- Litter collection services | Refuse collection services | Collection of hazardous waste | Hospital and laboratory waste...
- Bristol
- United Kingdom
supplyautonomy.com/lgskiphireltd.gb
Builders in Bury
Here at L&G Skip Hire Ltd, we are dedicated to providing the highest quality service in waste removal. We offer a range of different sizes to suit every pocket and need. Our... Read More »
- Houses construction work | Building construction work | Hotel construction work | Hostel construction work |...
- Bury
- United Kingdom
supplyautonomy.com/ferom.lv
Company is engaged in metal, scrap metal and recycled raw material (plastic, film, waste paper) management, recycling and trade. Fero M is the largest scrap metal management company in whole Zemgale... Read More »
- Recycling and reprocessing services for plastics | Sorting, cleaning and washing services for contaminated polyolefin...
- Jelgava
- Latvia
supplyautonomy.com/crmsynergiessl.es
- Skips (hire/rental) | Metal-plastic separation and recovery services | Ferrous metal recovery services | Aluminium...
- Las ventas de retamosa
- Spain
supplyautonomy.com/derplassa.es
- Recycling and reprocessing services for plastics | Sorting, cleaning and washing services for contaminated polyolefin...
- Zarátamo
- Spain
supplyautonomy.com/greencrosshealthinnovation.in
Green Cross Health Innovation with an objective to provide healthcare solutions, without side effects, launches its brand VitaGreen. The company produces an extensive range of Ayurveda/Herbal... Read More »
- Recovery and regeneration of volatile organic compounds (VOC) | Pharmaceutical articles | Gastrointestinal healthcare...
- Mumbai
- India
supplyautonomy.com/ashokabearingenterprises.in
Distibuter Of Bearing & Condition Monitiring Instrument.
- Glass recycling | Shower trays, resin-stone | Baths, vitreous china | Washbasins, vitreous china | Sinks, vitreous...
- New Delhi
- India
supplyautonomy.com/naathindustriespvt.in
Indenting Agents for Used Clothing, Acrylic / Woollen Rags & Hosiery, Synthetic Fibres and Wastes, Greasy & Scoured Wool.
- Washing services, wool | De-woolling services | De-tarring services, wool | Tearing services, wool | Garnetting...
- Mumbai
- India
supplyautonomy.com/economosfrance.fr
- Glass recycling | Refractory materials, metakaolin | Refractory materials, alumina rich clay based, 45 to 85% aluminium...
- Pontaut
- France
supplyautonomy.com/crisca.fr
- Metal-plastic separation and recovery services | Ferrous metal recovery services | Aluminium recovery | Brass recovery...
- Lyon
- France
supplyautonomy.com/developpementbernardplasencia.fr
- Pharmaceutical production engineering consultants | Biochemical engineering consultants | Regeneration services for...
- Saint-Priest
- France
supplyautonomy.com/seegarnifersarl.fr
- Dumper trucks (hire/rental) | Skips (hire/rental) | Metal-plastic separation and recovery services | Ferrous metal...
- Viry-Châtillon
- France
supplyautonomy.com/circoenvironnementeurope.fr
supplyautonomy.com/folagag.ch
- Recycling and reprocessing services for plastics | Sorting, cleaning and washing services for contaminated polyolefin...
- Sempach
- Switzerland
supplyautonomy.com/firstmagneticfrance.fr
- Metal-plastic separation and recovery services | Ferrous metal recovery services | Aluminium recovery | Brass recovery...
- Roncq
- France
supplyautonomy.com/antonioespanaehijossl.es
Antonio Espana e Hijos, S.L is a family owned company founded in 1954 by Antonio Espana Lavado.
From the very beginning scrap recovering and industrial and urban waste management are the core... Read More »
- Scrap iron - salvaging and recycling | Aluminum scrap
- Huelva
- Spain
supplyautonomy.com/seaserviziecologiciambientalisrl.it
Environmental safety. Sea Ambiente operates its own installations and is able to offer environmentally-responsible storage and processing of all type of industrial waste, hazardous and non-hazardous.... Read More »
- Decontamination of industrial waste | Refuse treatment - companies | Treatment of industrial waste water | Waste...
- Camerata
- Italy
supplyautonomy.com/sgomberirecuperorottamirifiutimetalliferrosidiantoniofocardicsas.it
Company established in 1978 specialising in scrap metal collection.
- Treatment of electrical and electronic waste | Engine disposal | Decontamination of industrial waste | Building debris...
- Sesto San Giovanni
- Italy
supplyautonomy.com/danrecas.dk
- Recycling and reprocessing services for plastics | Sorting, cleaning and washing services for contaminated polyolefin...
- Karup
- Denmark
supplyautonomy.com/hafneredelmetallgmbhcokg.de
- Cutting services, water jet, for textiles and textile composites | Wood turning services | Wood moulding services |...
- Pforzheim
- Germany
supplyautonomy.com/umarasuab.lt
supplyautonomy.com/vallettijosephsrl.it
Dear sir/Dear Madame,
With this we are pleased to bring to your attention information about our company Valletti Joseph Srl located in Ercolano via Cupa Viola, 13 80056 (Napoli), since 1976 it s a... Read More »
- Clothing - import-export | Textiles - recovery and recycling
- Ercolano
- Italy
supplyautonomy.com/bernhardtradeconsulting.de
- Metal-plastic separation and recovery services | Ferrous metal recovery services | Aluminium recovery | Brass recovery...
- Dusseldorf
- Germany