Loading...
Mga Resulta ng Paghahanap para sa: Kemikal at pharmaceutical mga serbisyo
Nahanap 549 kumpanyasupplyautonomy.com/hrsprocesssystems.in
Manufacturers, Exporters & Importers Of Wide Range Of Heat Exchangers, ECOFLUX* Corrugated Tube Heat Exchanger, Shell And Tube Heat Exchanger, UNICUS® Scraped Surface Heat Exchanger, ... Basahin Higit pang mga »
- Produksyon ng mga serbisyo, dietary supplements | Blending ng mga gamot | Spray pagpapatayo ng mga gamot | Protina...
- Pune
- India
supplyautonomy.com/johnsonmattheyfuelcellslimited.gb
Export Johnson Matthey is a speciality chemicals company focussed on its core skills in precious metals, catalysts and fine chemicals. It is organised into three global divisions: Environmental... Basahin Higit pang mga »
- Pagbabagong-buhay ng mga catalysts | Pagbabagong-buhay para sa mga serbisyo activate carbon | Pagbawi at...
- London
- United Kingdom
supplyautonomy.com/robinsonwirecloth.gb
Robinson Wire Cloth Ltd are a supplier of all types of filter meshes and materials. Our extensive in-house facilities enable us to manufacture woven mesh screens, tension screens and bonded screens... Basahin Higit pang mga »
- Sieving ng likido para sa industriya ng kemikal | Sieving ng solids para sa industriya ng kemikal | Sieving ng pastes...
- Stoke On Trent
- United Kingdom
supplyautonomy.com/upgreensas.fr
supplyautonomy.com/sweco.us
- Sieving ng solids para sa industriya ng kemikal | Humidifiers, pagkain, nakakain gulay langis processing | Heater,...
- Florence
- Estados Unidos
supplyautonomy.com/worldwaybiotech.cn
World-Way is specialized in marketing plant-derived extracts and fine chemicals for the nutraceutical, food and cosmetic industries for 15 years. World-Way is founded by Dr. Ginkgo Zeng, Professor in... Basahin Higit pang mga »
- Pag-uuri ng mga serbisyo, pinong mga kemikal | Fine kemikal | Iba pang mga pinong mga kemikal | Extracts
- Changsha
- China
supplyautonomy.com/kellyservices.fr
- Meteorolohiko consultant | Steam kapangyarihan consultant | Geophysics consultant | Hydrogeology consultant | Tubig...
- Clichy
- France
supplyautonomy.com/sofresidengineering.fr
- Pipework kontratista, chemical at nuclear maagos system | Pipework install kontratista, kemikal halaman | Pipework...
- Montigny-le-Bretonneux
- France
supplyautonomy.com/univar.fr
- Kemikal - import-export | Protina pagdalisay serbisyo | Sieving ng pastes para sa industriya ng kemikal | Air-uuri ng...
- Fontenay-sous-Bois
- France
supplyautonomy.com/mediwelllaboratories.in
We are An ISO 9001:2015 , certified and is listed on all Drug updates. Our sister concern are Mediwell wellness , mediwell wellness & Phytomolecules Marcwell Laboratories , All of our... Basahin Higit pang mga »
- Mga Gamit-Pampaganda processing | Herbal na gamot | Herbal na gamot | Personal na pag-aalaga mga produkto | Men...
- Ambala City
- India
supplyautonomy.com/shandongrunkechemicalco.cn
Shandong Runke Chemical Co., Ltd. was established in 2006 and finished holding and restructuring of Weifang Dacheng Salinization Co., Ltd. to the company in 2010. With a registered capital of 40... Basahin Higit pang mga »
- Paggawa ng iba pang mga produkto ng kemikal n.e.c. | Kemikal na mga produkto | Bromine, solid, likido o puno ng gas
- Weifang
- China
supplyautonomy.com/gujaratfluorochemicalslimited.in
Gujarat Fluorochemicals Limited (GFL) is an Indian Chemicals Company with over 30 years of expertise in Fluorine Chemistry. GFL holds domain expertise in Fluoropolymers, Fluorospecialities,... Basahin Higit pang mga »
- Produksyon ng mga kemikal | Kemikal
- Noida
- India
supplyautonomy.com/embelezarkosmetikinstitut.ca
So wie ich mir für meine Haut nur das Beste gönne, lege ich auch in meinem Kosmetikstudio in Frankfurt größten Wert auf die Qualität meiner kosmetischen Produkte und Behandlungen. Als langjährig erfah... Basahin Higit pang mga »
- Cosmetic paggamot mga serbisyo | Mga Gamit-Pampaganda processing
- Frankfurt am Main
- Germany
supplyautonomy.com/shandongsunshinechemicaltechnologyco.cn
Shandong Sunshine Chemical Technology Co., Ltd. specializes in R&D, production and management of disinfectant, additives and polymer, and its factory was built in accordance with GMP standards.... Basahin Higit pang mga »
- Paggawa ng iba pang mga produkto ng kemikal n.e.c. | Murang luntian generators para sa swimming pool | Kemikal na mga...
- Yanggu
- China
supplyautonomy.com/northeastagrochem.cn
Agrochemicals products.
Main products: Malathion, Chlorpyrifos, Thiamethoxam, and others. (Technical and Formulation)
Aгрохимикатов продукции.
Основная продукция: Малатион, Хлорпирифос, Тиаметокса... Basahin Higit pang mga »
- Paggawa ng pesticides at iba pang mga produkto ng agrochemical | Agrochemical | Agrochemical | Iba Agrochemical at...
- Jinxi
- China
supplyautonomy.com/chemiplastinternational.pk
Chemiplast International is a strong, family rooted company – founded by a cotton trading veteran Mr. Abid Ali (late) in 1999 with a vision to make Chemiplast one of the leading trading companies ... Basahin Higit pang mga »
- Polyurethane (pu) | Polymer | Solvents | Paggawa ng iba pang mga produkto ng kemikal | Paggawa ng mga kemikal at...
- Karachi
- Pakistan
supplyautonomy.com/texmor.mx
In 1981, the painting factory Permil S.A. of C.V. I think you will sit in the market of the surest. Our mission is to protect and decorate beautifully designed motifs for the three brothers, written... Basahin Higit pang mga »
- Paggawa ng Mga tina at Pang-kulay | Paggawa ng paints, varnishes at katulad Pintura, pagpi-print ng tinta at mastics |...
- Xochitepec
- Mexico
supplyautonomy.com/varunpolymers.in
Varun Polymers is one of the leading manufacturer and exporter in India, of premium quality recycled rubber products. We manufacture rubber reclaiming agent such as:
1 Di Aryl Di Sulphide
2 ... Basahin Higit pang mga »
- Custom kemikal serbisyo | Ball Valve | Plastic mga produkto | Pandikit at tape | Moulded mga bahagi, fused kuwarts
- Ahmedabad
- India
supplyautonomy.com/lgobbisrl.it
- Produksyon ng mga serbisyo, dietary supplements | Pagbabagong-buhay ng mga catalysts | Pagbabagong-buhay para sa mga...
- CAMPO LIGURE (GE)
- Italya
supplyautonomy.com/todecasa.es
- Pag-uuri ng mga serbisyo, pinong mga kemikal | Paglilinis ng kemikal | Pampaalsa para sa industriya ng inumin |...
- Barcelona
- Espanya
supplyautonomy.com/eastmanchemicalcompany.us
- Custom kemikal serbisyo | Sosa, likido | Sosa metabisulphite / sosa pyrosulphite | Sosa methoxide / sosa methylate |...
- Kingsport
- Estados Unidos
supplyautonomy.com/pelletspharmalimited.in
Manufacturers & Exporters of Sustained / Modified Release Pellets / Micro Granules - Retardstomized Development And Manufacturing Of SR Pellets/Micro Granules-Retard of Various Active... Basahin Higit pang mga »
- Blending ng mga gamot | Paghahanda para sa nervous system ng karamdaman, sedatives, tranquillizers, Chinese medicine |...
- Hyderabad
- India
supplyautonomy.com/islandwidemarketingservicespvt.lk
Import & Supply of Industrial Chemicals,Machinery Lab Equipment,Packaging along with the Technological Inputs & Clearing & Forwarding Agents,Export of Coconut based... Basahin Higit pang mga »
- Pagbawi at pagbabagong-buhay ng mga pabagu-bago ng isip organic compounds (voc) | Protina pagdalisay serbisyo | Sieving...
- Rajagiriya
- Sri Lanka
supplyautonomy.com/developpementbernardplasencia.fr
- Pharmaceutical produksyon engineering consultant | Biochemical engineering consultant | Pagbabagong-buhay para sa mga...
- Saint-Priest
- France
supplyautonomy.com/aircontrolsa.es
- Paglamig ng halaman, bantay-bilangguan proyekto | Produksyon ng mga serbisyo, dietary supplements | Blending ng mga...
- San Sebastián
- Espanya
supplyautonomy.com/borgessa.es
- Grouting, batay plaster | Produksyon ng mga serbisyo, dietary supplements | Kalakal negosyante, raw at goma LaTeX |...
- Reus
- Espanya
supplyautonomy.com/crealis.fr
- Pamamahala ng payo | Paglilinis ng kemikal | Nililinis ang mga produkto, kemikal, para sa electric at electronic...
- Bry
- France
supplyautonomy.com/epiingredients.fr
- Blending ng mga gamot | Blending ng paints at kulay para sa industriya ng kemikal | Ginger langis | May pulbos at...
- Ancenis
- France
supplyautonomy.com/ktronfrance.fr
- Produksyon ng mga serbisyo, dietary supplements | Pagpuno at packaging serbisyo, solvents at Pandikit, pang-industriya...
- Croissy-sur-Celle
- France
supplyautonomy.com/hosokawamicronlimited.gb
Hosokawa Micron Ltd is your single source for integrated powder processing systems and containment solutions. Our core products and services include particle design for nano technology, size... Basahin Higit pang mga »
- Naghahalong mabuti at blending teknolohiya consultant engineering | Produksyon ng mga serbisyo, dietary supplements |...
- Runcorn
- United Kingdom