에 대한 검색 결과 : 포장 기계

발견 4346 회사


supplyautonomy.com/pawantradingco.in
With our excellent performance in the arena of Precision Spares and Machineries, we are a well-known brand by the name o.
  • 포장 기계
  • Kolkata
  • 인도
supplyautonomy.com/shreejiprojects.in
  • 식품 산업 플랜트 및 장비 NES | 포장 기계 | 필링 머신
  • Ahmedabad
  • 인도
supplyautonomy.com/royalpackindustries.in
Royal Pack Industries was incepted in the year 2003, as a manufacturer, importer, exporter, supplier and trader of various packaging machinery. We have a large line of products in which, we offer... 자세히보기 »
  • 포장 기계
  • Mumbai
  • 인도
supplyautonomy.com/packsolindustries.in
The pramukh industries range of form-fill-seal machines are available in many models depending on the material being filled and the speed required. It can fillseal PVC or laminated sheets in pouches... 자세히보기 »
  • 사용 마이닝 기계 | 포장 기계
  • Vasai
  • 인도
supplyautonomy.com/mectropack.in
MECTROPACK. Specialized in all types of pouch and carton packaging machine manufacturing, company Our product include manufacturer exporter of all types of packing like powder packing machine,... 자세히보기 »
  • 포장 기계
  • Faridabad
  • 인도
supplyautonomy.com/marsonsprintgrafmachinespvt.in
  • 접착제 및 테이프 | 인쇄 및 그래픽 장비 | 윤전 그라비어 인쇄 기계 | 포장 기계 | 스탬핑 포일...
  • Mumbai
  • 인도
supplyautonomy.com/grafikmachineryexchangeindia.in
Most advanced technology and best products at great prices; since 1989... Grafik Machinery Exchange India is a well known brand in the printing industry for its technical wizardry. We were ... 자세히보기 »
  • 포장 기계
  • New Delhi
  • 인도
supplyautonomy.com/drmachinetools.in
D.R. Machine Tools is a highly recognized manufacturer, supplier and exporter offering unmatched Pilfer Proof Caps making Machinery. Incorporated in the year 1996, the company has carved a special... 자세히보기 »
  • 포장 기계
  • New Delhi
  • 인도
supplyautonomy.com/stitchexpertsindia.in
We, Stitch Experts India, are one of the leading companies in the domains of bag handling systems since our formation in 1992. With years of industry knowledge and experience to offer increased... 자세히보기 »
  • 포장 기계
  • New Delhi
  • 인도
supplyautonomy.com/jmcpapertechpvt.in
An eminent company exhibiting expertise in providing premium quality machines like Pulper with Belt Conveyor, JMC Hi Consistency Pulper, Turbo Separator, M.G. Cylinder, Paper Machine Dryer Section,... 자세히보기 »
  • 포장 기계
  • Ahmedabad
  • 인도
supplyautonomy.com/vjstrappingsystems.in
To cater to the requirements of packaging and other industries, we, VJ STRAPPING SYSTEMS are dedicated in providing various machinery and other packaging materials to the clients. Started in the year... 자세히보기 »
  • 접착제 및 테이프 | 포장 기계
  • Yanam
  • 인도
supplyautonomy.com/friendspackaging.in
Our consistent growth has spanned the period of 15 years, during which we have unveiled a number of leading-edge innovations, and acquired the distinguished expertise in our field. Friends Packaging... 자세히보기 »
  • 포장 기계
  • Faridabad
  • 인도
supplyautonomy.com/shreechamundamicroindustries.in
Showcasing supreme quality Packing Machine, Automatic Packing Machine, Form Fill & Sealing Machine based Cup Systems, Semi-automatic Liquid Filling Machines, Horizontal Flow Wrapping Machines,... 자세히보기 »
  • 포장 기계
  • Ahmedabad
  • 인도
supplyautonomy.com/swanpackpackagingmachinespvt.in
Packaging enhances the look of the product and enables in retaining the quality of the product for longer time. Comprehending the increasing need for these, we Swanpack Packaging Machine, deal in... 자세히보기 »
  • 포장 기계
  • Hyderabad
  • 인도
supplyautonomy.com/ramoliaenterprise.in
A name you can bank upon, Ramolia Enterprise is one of the key Suppliers, Traders and Service Providers of a wide range of electrical products. Our array of products includes Electrical Air Vessels,... 자세히보기 »
  • 포장 기계 | 컴프레서 및 동종 장비
  • Ahmedabad
  • 인도
supplyautonomy.com/dolphinprocessautomationpvt.in
  • 경영 컨설팅 | 전자 공급 | 용접 장비 | 포장 기계 | 교육 서비스
  • Gurgaon
  • 인도
supplyautonomy.com/omgajananpackaging.in
In the recent time, the packaging industry has witnessed a steep growth, and eventually need of custom built packaging machines are needed for the packaging industry. With our years of expertise and... 자세히보기 »
  • 플라스틱 제품 | 포장 기계
  • Pune
  • 인도
supplyautonomy.com/rdsingalco.in
R. D. Singal & Co, "The Admired & The Reliable", has been serving as a packaging solution provider and has made substantial inroads on the packaging industry. We at R. D. Singal... 자세히보기 »
  • 포장 기계
  • Delhi
  • 인도
supplyautonomy.com/nandaelectricals.in
World class heating elements at highly competitive price...Backed with 35 years of rich industry experience, we have come through some brilliant phases of success and development to be the leading... 자세히보기 »
  • 포장 기계
  • Amritsar
  • 인도
supplyautonomy.com/koleyconvertingmachinerypvt.in
We are manufacturer, supplier and exporter of rotogravure printing machine, rotogravure printing press, high speed rotogravure printing press and high speed rotogravure printing machines.
  • 포장 기계
  • Howrah
  • 인도
supplyautonomy.com/superpackpackagingmachinespvt.in
With rich experience of more than a decade, Superpack Packaging Machines Pvt. Ltd. commenced business in the year 1995, and since then we have been a renowned manufacturer, exporter and supplier of L... 자세히보기 »
  • 포장 기계
  • Hyderabad
  • 인도
supplyautonomy.com/shreejishrinksystem.in
We the manufacturer and exporter of packaging machinery, food packaging machinery, vacuum packaging machinery, shrink packaging machinery, packaging machinery company, we also offer carton packaging... 자세히보기 »
  • 포장 기계
  • Mumbai
  • 인도
supplyautonomy.com/ishidaindiapvt.in
Established in the year 2007, Ishida India Pvt. Ltd. has rapidly made its name a reckoned one in the entire industry. With commendable performance in a few years, we have carved a distinct niche in... 자세히보기 »
  • 포장 기계
  • Gurgaon
  • 인도
supplyautonomy.com/brotherspharmamach.in
  • 세척 장비 | 포장 기계 | 제약 포장기
  • Ahmedabad
  • 인도
supplyautonomy.com/ethioplasticspvt.in
  • 금형 | 포장 기계 | 컨테이너, 금속 | 미네랄 워터스
  • Mumbai
  • 인도
supplyautonomy.com/goldenmachinexcorporation.in
A time honored organization, with an experience that sprawls across half a century, we, Golden Machinery Corporation, are one of the most reputed names throughout the Indian subcontinent. As a... 자세히보기 »
  • 잘 드릴링 기계 | 포장 기계
  • Kolkata
  • 인도
supplyautonomy.com/sensotechweighingsystems.in
The in-depth domain knowledge and support of latest process technology allow Sensotech Weighing Systems to serve quality conscious customers with complete range of weighing products. Incepted in the... 자세히보기 »
  • 전자 공급 | 포장 기계 | 저울 무게
  • Indore
  • 인도
supplyautonomy.com/adlerexports.in
  • 문방구 | 원예 용품 | 잘 드릴링 기계 | 포장 기계 | 의료 기기
  • Rajkot
  • 인도
supplyautonomy.com/creedengineerspvt.in
  • 포장 제품 대리점 | 인쇄 및 그래픽 장비 | 포장 기계 | 인쇄물 및 관련 제품 | 인쇄 잉크 및 페인트 원료...
  • Gurgaon
  • 인도
supplyautonomy.com/hardabarteryhouse.in
  • 밀 | 팬츠 & 바지 | 지갑 | 플라스틱 제품 | 포장 기계 | 의류, 여성 | 옷
  • Veraval
  • 인도