Torthaí Cuardaigh le haghaidh: Innealra pacáistiú

4346 comhlachtaí Aimsíodh


supplyautonomy.com/trustarpharmapackingequipment.cn
Wenzhou Trustar Machinery Technology co.,ltd.is located in Ruian, Wenzhou, the capital of packaging and printing. The factory covers an area of about 7000 square meters and the office building area... Read More »
  • Innealra pacáistiú
  • Wenzhou
  • An tSín
supplyautonomy.com/tangshankingvidaprintingmachineryco.cn
The outstanding Tangshan Kingvida Printing Machinery Co., Ltd. is a professional manufacturer of printing and packaging machinery. Located in the central area of Beijing,Tianjin and Tangshan.The... Read More »
  • Páipéar gearradh - innealra agus trealamh | Innealra pacáistiú | Carton folding agus glueing meaisíní
  • Yutian County
  • An tSín
supplyautonomy.com/zhejiangruianyongtaipackingmachinerymanufactureco.cn
Zhejiang Ruian Yongtai Packing Machinery Manufacture Co., Ltd is specialized in producing complete sets of flexible packaging equipment and has a long history. We specially produce various plastic... Read More »
  • Innealra mála a dhéanamh | Mála a dhéanamh páirteanna innealra | Innealra priontála | Pacáiste cairtchláir roctha meaisí...
  • Wenzhou
  • An tSín
supplyautonomy.com/guangdongqishengmachineryco.cn
  • Laghdaigh meaisíní timfhilleadh scannán | Innealra pacáistiú | Il-fheidhm meaisín pacáistiú | Meaisíní timfhilleadh | Pa...
  • Foshan
  • An tSín
supplyautonomy.com/lindumpackaging1.gb
We analyse what constraints are preventing our customers from achieving optimum efficiency. We know that they need the right products, in the right place, at the right time. Production Can’t Stop ... Read More »
  • Comhairleoirí taighde Pacáistiú | Tástáil pacáistí agus ábhair phacáistíochta | Seirbhísí Pacáistiú | Cásanna agus cófra...
  • Stallingborough, North East Lincolnshire
  • An Ríocht Aontaithe
supplyautonomy.com/soonkpackagingmachine.cn
Foshan Soonk Packaging Machine Co., Ltd. is a professional advanced enterprise engaged in packaging machine research and development, design, production, sales and maintenance.
  • Innealra pacáistiú agus trealamh, dara-láimhe | Séalaithe agus beartán - innealra agus trealamh | Pacáil agus pacáistiú ...
  • Foshan
  • An tSín
supplyautonomy.com/tubitexspa.it
Paperboard tubes and cores - Packaging articles and products - Paperboard cases and boxes for packaging
  • Tráidirí, clár snáithíneach | Feadáin, páipéar nó clár snáithíneach | Feadáin, páipéar nó clár snáithíneach, créachta | ...
  • Zona Industriale
  • An Iodáil
supplyautonomy.com/antoniodominicifratellicostruzionimeccanichesrl.it
Production of machinery for the baking and food industries. Robotized systems for handling, chocolate egg wrappers, chocolate coin wrappers, nougat cookers and cutters, bakery machinery, automatic... Read More »
  • Meaisíní kneading do-arán agus taosráin a dhéanamh- | Kneading agus a mheascadh innealra agus trealamh, milseogra | Mhún...
  • Perugia
  • An Iodáil
supplyautonomy.com/bidllc.ua
BID company - Pasta and packaging equipment manufacture Dear Sirs! The distinctive mark of our company is a wide range of pasta, drying and packaging equipment, which allows to produce pasta... Read More »
  • Meaisíní kneading do-arán agus taosráin a dhéanamh- | Plandaí tionscail bhia agus nes trealamh | Stoc Innealra | Pacáil ...
  • Dnepropetrovsk
  • An Úcráin
supplyautonomy.com/rakshapackaging.in
The company formed in the year 1976 as a-class ancillary suppliers diversified into the field of packaging by the name of Raksha Packaging in the year 1994. The growth in packaging industry is far... Read More »
  • Iompróirí, plaisteach, le haghaidh seachadadh pizza | Scannán, plaisteach, ar earraí bia | Málaí, plaisteach, ar earraí ...
  • Faridabad
  • An India
supplyautonomy.com/riddhipharmamachinery.in
Manufacturers and Exporters of Pharmaceutical Machineries. Our multitude of products include Pharmaceutical Machinery, Tablet Press Machine, Rotary Tablet Press Machine, Fluid Bed Dryer, Tray drier,... Read More »
  • Plandaí tionscail bhia agus nes trealamh | Extruders, tionscail cógaisíochta agus cosmaideacha | Monarcha próiseála ola,...
  • Mumbai
  • An India
supplyautonomy.com/acmemachineryindiapvt.in
Acme Machinery (India) Pvt. Ltd. is a professionally managed organization accredited for manufacturing and exporting of Paper Board Printing, Packaging and Converting Machineries since... Read More »
  • Meaisíní Cairtchlár, leanúnach, sorcóir | Múnlaí, sorcóir, a dhéanamh cairtchlár | Meaisíní calendering, cairtchlár agus...
  • Mumbai
  • An India
supplyautonomy.com/gdspa.it
G.D is the world's leading cigarette production and packaging machinery constructor. Its vast array of solutions makes G.D. the only company in a position to offer complete high-speed lines.
  • Moisturisers, a mhonarú coisbheart | Plandaí Fuarú haghaidh tobac gearrtha | Comhdhlúthadáin, ola-ite agus táirgeadh sai...
  • Bologna
  • An Iodáil
supplyautonomy.com/reconmachinetoolspvt.in
Recon is a leading manufacturer of Plant and Machinery for Metal Cans, Metal Closures Steel Drums, also complete packaging lines for powder, liquid paste in metal containers. Established in the... Read More »
  • Is féidir Ilchodach innealra a dhéanamh | Córais iompar, is féidir agus is féidir clúdach | An féidir agus innealra a gh...
  • Mumbai
  • An India
supplyautonomy.com/assopackmachines.in
We have created a niche among quality-oriented corrugators. Our name inspires confidence not only among Indian corrugators but it is known for its reliability of its products in foreign markets... Read More »
  • Dtochras, foirceannadh agus meaisíní msgstr, papermaking | Foirceannadh, meaisíní msgstr agus gearradh, il-oibriúcháin, ...
  • Ahmedabad
  • An India
supplyautonomy.com/gangasinghengineeringpvt.in
ESSGEE Exports is a proprietary concern established in 1993 and are very strong in exporting machinery which are mainly used in tin container industry, packaging industries and having vast knowledge... Read More »
  • Uirlisí Tógálaithe ' | Plandaí tionscail bhia agus nes trealamh | Innealra Well-druileála | Innealra teicstíle Eile | Lí...
  • Mumbai
  • An India
supplyautonomy.com/apsaraengineers.in
We the manufacturers and exporters of all kinds of textile related machinery, we are specialist in polyfill opening machinery, pillow packing machinery and blowfill machines in nominal cost. We... Read More »
  • Spóil, eiteáin, cóin, plaisteach, d'innealra teicstíle | Feadáin Spinning, plaisteach | Cárta agus líníocht cannaí, plai...
  • Coimbatore
  • An India
supplyautonomy.com/foshancitycoretamppackingmachineryco.cn
Foshan Coretamp Packaging Machinery Co.,Ltd. is located in China Machinery Center - Foshan city, takes 30 minutes to Guangzhou and 2 hours to Shenzhen/Hong Kong. We are a leading manufacturer of all k... Read More »
  • Innealra pacáistiú
  • Foshan
  • An tSín
supplyautonomy.com/excellpacks.in
Welcome Empowering people through prosperity and helping them create wealth have been the mission of VK Engineering & Company since 2000 VK Engineering & Company and heir... Read More »
  • Pacáil agus pacáistiú - innealra agus trealamh | Innealra agus trealamh pacáistiú | Innealra pacáistiú | Páirteanna inne...
  • Coimbatore, Tamil Nādu
  • An India
supplyautonomy.com/cooltechenterprises.in
A renowned name in the domain of Cooling Pads, ABS Ductable Cooling Machine, Desert/Room Coolers, etc., Cool Tech Enterprises has been offering quality to the clients. Combining technology and wide... Read More »
  • Gníomhairí táirge Slándáil | Priontáil aistriú | Seirbhísí mhúnlú insteallta, miotail | Ábhair insliú | Custom dearadh S...
  • Amravati
  • An India
supplyautonomy.com/chamundaindustries.in
We are pleased to introduce ourselves as one of the leading Exporters, Manufacturers , Stockists Supplier of stainless steel item,ferrous non-ferrous metal which are required by your company in... Read More »
  • Gníomhairí táirge Slándáil | Priontáil aistriú | Seirbhísí mhúnlú insteallta, miotail | Ábhair insliú | Custom dearadh S...
  • Mumbai
  • An India
supplyautonomy.com/preciousmineralprocessingsystemspvt.in
CHITRA PHARMA MACHINERY PRECIOUS FAB-CAST PVT. LTD. , the parent company of CHITRA PHARMA MACHINERY-an ISO 9001: 2000 company is the designer, developer, manufacturer and exporter of various... Read More »
  • Glanadh Trealamh | Plandaí tionscail bhia agus nes trealamh | Innealra Well-druileála | Uirlisí meaisín do shaoirsiú mio...
  • Ahmedabad
  • An India
supplyautonomy.com/kusodalamuthucopvt.in
Bharath Paper Conversions are manufacturers and exporters of high quality Paper Cones, Paper Tubes, Paper Cores, Edge Protectors, Composite Cans and Pulp Moulded Products. Established in 1984, the... Read More »
  • Tráidirí, clár snáithíneach | Feadáin, páipéar nó clár snáithíneach | Feadáin, páipéar nó clár snáithíneach, créachta | ...
  • Coimbatore
  • An India
supplyautonomy.com/seniorprintpackmachineryco.in
Manufacturers & Exporters Of Corrugated Board, Box Making Machinery, Corrugated Board Making Plant, Die Punching, Cutting, Creasing & Embossing Machine, Hot Foil Stamping Die Cutting... Read More »
  • Innealra mála a dhéanamh | Priontáil agus trealamh grafaicí | Innealra sórtáil Páipéar agus trealamh | Meaisíní leagan (...
  • Hyderabad
  • An India
supplyautonomy.com/finopack.cn
An open mouth bagging machine is an automatic filling and sealing machine which fills products into bags up to a specific weight, and closes the bag mouth automatically. Our automatic bagging and... Read More »
  • Innealra agus trealamh pacáistiú | Innealra pacáistiú | Páirteanna innealra pacáistiú
  • Hefei
  • An tSín