Loading...
জন্য অনুসন্ধান ফলাফল: ক্রীড়া এবং অবসর সুবিধা অপারেশন
পাওয়া 13336 কোম্পানিsupplyautonomy.com/curemedspa.us
WE ARE THE #1 NON-INVASIVE COSMETIC MEDICAL PRACTICE AND WELLNESS CENTER IN MYSTIC, CT.
Our priority is to create an experience for your body, mind, and spirit, with a results-driven treatment plan... আরো পড়ুন »
- স্পা সেবা
- Mystic
- মার্কিন যুক্তরাষ্ট্র
supplyautonomy.com/gettinlippywithbritaesthetics.us
Gettin Lippy With Brit Aesthetics is passionate about helping patients be their best selves by enhancing their natural beauty and slowing down the clock with botox-neurotoxin, Dysport, Xeomin,... আরো পড়ুন »
- স্পা সেবা
- Fort Worth
- মার্কিন যুক্তরাষ্ট্র
supplyautonomy.com/aesthetify.us
At Aesthetify, we're dedicated to providing medical care that's as unique as you are. We recognize that each person is a unique canvas, shaped by their history, lifestyle, and aspirations.... আরো পড়ুন »
- স্পা সেবা
- Watchung
- মার্কিন যুক্তরাষ্ট্র
supplyautonomy.com/quiktox.us
Welcome to QUIKTOX™ Injection Studio, where we revolutionize the way Tox treatments are delivered. Founded and funded by industry veterans, our clinic is built upon a foundation of deep domain m... আরো পড়ুন »
- স্পা সেবা
- Costa Mesa
- মার্কিন যুক্তরাষ্ট্র
supplyautonomy.com/foreveryoungmedispasugarlandtx.us
Forever Young Medi Spa is your one-stop Medical Spa for all your beauty and wellness needs. Our team of licensed professionals is dedicated to helping you look and feel your best, using only the most... আরো পড়ুন »
- স্পা সেবা
- Sugar Land
- মার্কিন যুক্তরাষ্ট্র
supplyautonomy.com/allureaesthetics.us
At Allure, we like to understand your beauty & aesthetic goals so we can guide you to the right services and products. We offer monthly specials which are shared on both social media & on our... আরো পড়ুন »
- স্পা সেবা
- Great Falls
- মার্কিন যুক্তরাষ্ট্র
supplyautonomy.com/dolcevidamedicalsparidgefield.us
Dolce Vida Med Spa is a full-service medical aesthetics resource serving men and women from in and around Greenwich, Westport, Ridgefield, Trumbull, and Hamden, Connecticut. Under the leadership of... আরো পড়ুন »
- স্পা সেবা
- Ridgefield
- মার্কিন যুক্তরাষ্ট্র
supplyautonomy.com/inglofaceandbodysculpting.us
At IN•GLO™ Face and Body Sculpting Med Spa we have certainly done our best to perfect them. Dedicating ourselves to the craft, we maintain the knowledge necessary to demonstrate our services to those ... আরো পড়ুন »
- স্পা সেবা
- New York
- মার্কিন যুক্তরাষ্ট্র
supplyautonomy.com/rajeunirmedical.us
At Rajeunir Medical, Seattle's premier aesthetics & wellness center & med spa, Dr. Mona Shawky's expertise for personalized, concierge-level care prioritizes your health and... আরো পড়ুন »
- স্পা সেবা
- Mercer Island
- মার্কিন যুক্তরাষ্ট্র
supplyautonomy.com/austexwellnessandmedicalspa2.us
AUSTEX is a top Medical Spa in Austin, TX. We service all of Austin including, Lakeway, Bee Cave, Spicewood, Four Points, Westlake, and Dripping Springs. We are one of the only Medical Spas to offer... আরো পড়ুন »
- স্পা সেবা
- Lakeway
- মার্কিন যুক্তরাষ্ট্র
supplyautonomy.com/pausepainwellness3a.us
Mississippi's #1 Medical Card Referral Clinic with multiple statewide locations to serve you.
We do more than get you approved for your medical cannabis card. Pause Pain & Wellness is... আরো পড়ুন »
- উপচার
- Olive Branch
- মার্কিন যুক্তরাষ্ট্র
supplyautonomy.com/priveosanté.ca
Priveo Santé was born out of a vision to create a welcoming, comfortable and warm environment for everyone who walks through our doors. We are aware that your health is a priority, which is why we ... আরো পড়ুন »
- উপচার
- Laval
- কানাডা
supplyautonomy.com/upliftaesthetics.us
Let us help you feel like you again! We offer Botox, Filler, and skin care solutions to help you regain your sense of self, increase self confidence, and enhance or restore your natural beauty.... আরো পড়ুন »
- স্পা সেবা
- Oakdale
- মার্কিন যুক্তরাষ্ট্র
supplyautonomy.com/puredayspa.ca
We are a full service spa located in beautiful Mattick's Farm. Our staff of friendly and licensed estheticians cover all your spa needs. Our treatments include facials for all skin types,... আরো পড়ুন »
- স্পা সেবা
- Victoria
- কানাডা
supplyautonomy.com/signatureaestheticsivlounge.us
Our practitioners are board certified and proficient at the art of facial rejuvenation. Our services include injectables such as Botox and Dysport, Dermal Fillers, Micro-needling, Chemical Peels, and... আরো পড়ুন »
- স্পা সেবা
- Liberty Hill
- মার্কিন যুক্তরাষ্ট্র
supplyautonomy.com/colorectalclinicofmichigan1.us
Dr. Alame is board certified in general surgery and specializes in advanced colorectal surgical procedures. He earned his medical degree from the prestigious University of Miami in Florida. After... আরো পড়ুন »
- উপচার
- Saint Clair Shores
- মার্কিন যুক্তরাষ্ট্র
supplyautonomy.com/drsharonaesthetics.us
Dr. Sharon Aesthetics Medical Spa offers a wide variety of beauty enhancing procedures such as neurotoxins, dermal fillers, microneedling, Vampire facials/facelifts, “O” shot, “P” shot, hair restora... আরো পড়ুন »
- স্পা সেবা
- Houston
- মার্কিন যুক্তরাষ্ট্র
supplyautonomy.com/elevatemedandaesthetics.us
Elevate Medical and Aesthetic Spa is a place to be for all you aesthetic needs. We provide complete medical and wellness care in a peaceful environment that combines services offered in spa with... আরো পড়ুন »
- স্পা সেবা
- Plantation
- মার্কিন যুক্তরাষ্ট্র
supplyautonomy.com/adoromedicalspa1.us
Over the years, Dr. Pacheco has established a practice that takes pride in first-rate care, comprehensive rejuvenation, and in the satisfaction and comfort of it's patients. Dr. Pacheco's... আরো পড়ুন »
- স্পা সেবা
- Severna Park
- মার্কিন যুক্তরাষ্ট্র
supplyautonomy.com/bluedivine.us
Blue Divine is an Atlanta med spa focusing on all skin tones with dual wavelength YAG & Alexandrite laser hair removal, & Aerolase YAG laser facials, Cynosure signature laser facials, medical... আরো পড়ুন »
- স্পা সেবা
- Atlanta
- মার্কিন যুক্তরাষ্ট্র
supplyautonomy.com/vivantaestheticswellness.us
We believe that everyone is naturally beautiful and unique, but we also understand that most people have insecurities that can hold them back in their life. Our purpose is to enhance your natural... আরো পড়ুন »
- স্পা সেবা
- Itasca
- মার্কিন যুক্তরাষ্ট্র
supplyautonomy.com/afcurgentcaresouthcharlotte.us
Urgent Care South Charlotte. Located On the North Corner of Johnston Road Plaza, in front of Food Lion Grocery Store. AFC Urgent Care treats everything from cuts and bruises to fractures and colds... আরো পড়ুন »
- উপচার | রোগীদের জন্য চিকিৎসা
- Charlotte
- মার্কিন যুক্তরাষ্ট্র
supplyautonomy.com/veritareset.mx
Verita Reset is an integrative medical treatment center in Tijuana, Mexico specializing in the holistic treatment of chronic Lyme Disease, rheumatoid arthritis, lupus, mold toxicity, and other... আরো পড়ুন »
- উপচার
- Tijuana
- মক্সিকো
supplyautonomy.com/macleyfamilypracticeandwalkinclinic.us
Whether it is a minor sprain, fever, ear pain, or a complex medical problem, we are here for you. Our friendly and competent staff, including board-certified physicians, utilizes the latest medical... আরো পড়ুন »
- ক্লিনিক | উপচার | ডাক্তার পরামর্শ | ডাক্তার
- Duluth
- মার্কিন যুক্তরাষ্ট্র
supplyautonomy.com/texasveinexperts.us
Our team at Frisco consists of highly trained vascular specialists that diagnose and treat venous diseases including venous reflux using minimally-invasive techniques for more than 10 years. Take the... আরো পড়ুন »
- উপচার
- Frisco
- মার্কিন যুক্তরাষ্ট্র
supplyautonomy.com/dankrevolutionstore11.nl
Dank Revolution store provides visitors with reviews of the best medical cannabis strains.
Explore the latest cannabis news, Dank Revolution store tips, education and more from Dank Revolution... আরো পড়ুন »
- উপচার
- Capelle aan den IJssel
- নেদারল্যান্ডস
supplyautonomy.com/hermannaestheticswellness.us
Hermann Wellness offers a wide variety of spa services that include facials, peels, microdermabrasion treatments. A facial is a great way to take care of your skin, especially when coupled with a... আরো পড়ুন »
- উপচার
- St. Petersburg
- মার্কিন যুক্তরাষ্ট্র
supplyautonomy.com/globalmedicalcare.gb
For the past 5 years, Global Medical Care has been providing affordable high-standard medical treatments for patients from Switzerland and Europe. The Firm’s reputation has been built on an u... আরো পড়ুন »
- উপচার
- South Wimbledon
- যুক্তরাজ্য
supplyautonomy.com/nuhairmedical.ca
NuHair Medical offers state of the art surgical and non-surgical hair restoration for treatment of both female pattern baldness and male androgenic alopecia. Treatments offered include Follicular... আরো পড়ুন »
- উপচার
- Vancouver
- কানাডা
supplyautonomy.com/mdproactive.us
MDPROACTIVE is an online medical provider that aims to treat minor medical ailments for patients via the internet or smartphone, when they do not have convenient access to their primary care... আরো পড়ুন »
- উপচার
- Naperville
- মার্কিন যুক্তরাষ্ট্র