Loading...
Search Results for: Packaging machinery
Found 4346 companies
supplyautonomy.com/trustarpharmapackingequipment.cn
Wenzhou Trustar Machinery Technology co.,ltd.is located in Ruian, Wenzhou, the capital of packaging and printing. The factory covers an area of about 7000 square meters and the office building area... Read More »
- Packaging machinery
- Wenzhou
- China
supplyautonomy.com/tangshankingvidaprintingmachineryco.cn
The outstanding Tangshan Kingvida Printing Machinery Co., Ltd. is a professional manufacturer of printing and packaging machinery. Located in the central area of Beijing,Tianjin and Tangshan.The... Read More »
- Paper cutting - machinery and equipment | Packaging machinery | Carton folding and glueing machines
- Yutian County
- China
supplyautonomy.com/zhejiangruianyongtaipackingmachinerymanufactureco.cn
Zhejiang Ruian Yongtai Packing Machinery Manufacture Co., Ltd is specialized in producing complete sets of flexible packaging equipment and has a long history. We specially produce various plastic... Read More »
- Bag making machinery | Bag making machinery parts | Printing machinery | Corrugated cardboard package making machines |...
- Wenzhou
- China
supplyautonomy.com/guangdongqishengmachineryco.cn
supplyautonomy.com/lindumpackaging1.gb
We analyse what constraints are preventing our customers from achieving optimum efficiency. We know that they need the right products, in the right place, at the right time.
Production Can’t Stop ... Read More »
- Packaging research consultants | Testing of packages and packaging materials | Packaging services | Cases and chests -...
- Stallingborough, North East Lincolnshire
- United Kingdom
supplyautonomy.com/soonkpackagingmachine.cn
Foshan Soonk Packaging Machine Co., Ltd. is a professional advanced enterprise engaged in packaging machine research and development, design, production, sales and maintenance.
- Packaging machinery and equipment, second-hand | Sealing and wrapping - machinery and equipment | Packing and packaging...
- Foshan
- China
supplyautonomy.com/tubitexspa.it
supplyautonomy.com/antoniodominicifratellicostruzionimeccanichesrl.it
Production of machinery for the baking and food industries. Robotized systems for handling, chocolate egg wrappers, chocolate coin wrappers, nougat cookers and cutters, bakery machinery, automatic... Read More »
- Kneading machines for bread- and pastry-making | Kneading and mixing machinery and equipment, confectionery | Moulding...
- Perugia
- Italy
supplyautonomy.com/bidllc.ua
BID company - Pasta and packaging equipment manufacture
Dear Sirs!
The distinctive mark of our company is a wide range of pasta, drying and packaging equipment, which allows to produce pasta... Read More »
- Kneading machines for bread- and pastry-making | Food industry plant and equipment NES | Machinery stock | Packing and...
- Dnepropetrovsk
- Ukraine
supplyautonomy.com/rakshapackaging.in
The company formed in the year 1976 as a-class ancillary suppliers diversified into the field of packaging by the name of Raksha Packaging in the year 1994.
The growth in packaging industry is far... Read More »
- Carriers, plastic, for pizza deliveries | Film, plastic, for foodstuffs | Bags, plastic, for foodstuffs | Containers,...
- Faridabad
- India
supplyautonomy.com/riddhipharmamachinery.in
Manufacturers and Exporters of Pharmaceutical Machineries. Our multitude of products include Pharmaceutical Machinery, Tablet Press Machine, Rotary Tablet Press Machine, Fluid Bed Dryer, Tray drier,... Read More »
- Food industry plant and equipment NES | Extruders, pharmaceutical and cosmetic industries | Oil processing plant,...
- Mumbai
- India
supplyautonomy.com/acmemachineryindiapvt.in
Acme Machinery (India) Pvt. Ltd. is a professionally managed organization accredited for manufacturing and exporting of Paper Board Printing, Packaging and Converting Machineries since... Read More »
- Cardboard making machines, continuous, cylinder | Moulds, cylinder, cardboard making | Calendering machines, cardboard...
- Mumbai
- India
supplyautonomy.com/gdspa.it
G.D is the world's leading cigarette production and packaging machinery constructor. Its vast array of solutions makes G.D. the only company in a position to offer complete high-speed lines.
- Moisturisers, footwear manufacturing | Cooling plant for cut tobacco | Condensers, inedible oil and fat production |...
- Bologna
- Italy
supplyautonomy.com/reconmachinetoolspvt.in
Recon is a leading manufacturer of Plant and Machinery for Metal Cans, Metal Closures Steel Drums, also complete packaging lines for powder, liquid paste in metal containers.
Established in the... Read More »
- Composite can making machinery | Conveying systems, can and can lid | Can and cask cleaning and washing machinery | Can...
- Mumbai
- India
supplyautonomy.com/assopackmachines.in
We have created a niche among quality-oriented corrugators. Our name inspires confidence not only among Indian corrugators but it is known for its reliability of its products in foreign markets... Read More »
- Reeling, winding and rewinding machines, papermaking | Winding, rewinding and cutting machines, multi-operational,...
- Ahmedabad
- India
supplyautonomy.com/gangasinghengineeringpvt.in
ESSGEE Exports is a proprietary concern established in 1993 and are very strong in exporting machinery which are mainly used in tin container industry, packaging industries and having vast knowledge... Read More »
- Builders' tools | Food industry plant and equipment NES | Well-drilling machinery | Other textile machinery | Wire...
- Mumbai
- India
supplyautonomy.com/apsaraengineers.in
We the manufacturers and exporters of all kinds of textile related machinery, we are specialist in polyfill opening machinery, pillow packing machinery and blowfill machines in nominal cost.
We... Read More »
- Spools, bobbins, cones, plastic, for textile machinery | Spinning tubes, plastic | Card and drawing cans, plastic, for...
- Coimbatore
- India
supplyautonomy.com/foshancitycoretamppackingmachineryco.cn
Foshan Coretamp Packaging Machinery Co.,Ltd. is located in China Machinery Center - Foshan city, takes 30 minutes to Guangzhou and 2 hours to Shenzhen/Hong Kong. We are a leading manufacturer of all k... Read More »
- Packaging machinery
- Foshan
- China
supplyautonomy.com/excellpacks.in
Welcome
Empowering people through prosperity and helping them create wealth have been the mission of VK Engineering & Company since 2000
VK Engineering & Company and heir... Read More »
- Packing and packaging - machinery and equipment | Packaging machinery and equipment | Packaging machinery | Packaging...
- Coimbatore, Tamil Nādu
- India
supplyautonomy.com/cooltechenterprises.in
A renowned name in the domain of Cooling Pads, ABS Ductable Cooling Machine, Desert/Room Coolers, etc., Cool Tech Enterprises has been offering quality to the clients. Combining technology and wide... Read More »
- Security product agents | Transfer printing | Injection moulding services, metal | Insulation materials | Custom design...
- Amravati
- India
supplyautonomy.com/chamundaindustries.in
We are pleased to introduce ourselves as one of the leading Exporters, Manufacturers , Stockists Supplier of stainless steel item,ferrous non-ferrous metal which are required by your company in... Read More »
- Security product agents | Transfer printing | Injection moulding services, metal | Insulation materials | Custom design...
- Mumbai
- India
supplyautonomy.com/preciousmineralprocessingsystemspvt.in
CHITRA PHARMA MACHINERY
PRECIOUS FAB-CAST PVT. LTD. , the parent company of CHITRA PHARMA MACHINERY-an ISO 9001: 2000 company is the designer, developer, manufacturer and exporter of various... Read More »
- Cleaning equipment | Food industry plant and equipment NES | Well-drilling machinery | Machine tools for milling metal...
- Ahmedabad
- India
supplyautonomy.com/kusodalamuthucopvt.in
Bharath Paper Conversions are manufacturers and exporters of high quality Paper Cones, Paper Tubes, Paper Cores, Edge Protectors, Composite Cans and Pulp Moulded Products. Established in 1984, the... Read More »
- Trays, fibreboard | Tubes, paper or fibreboard | Tubes, paper or fibreboard, wound | Tubes, fibreboard, lined | Tubes,...
- Coimbatore
- India
supplyautonomy.com/seniorprintpackmachineryco.in
Manufacturers & Exporters Of Corrugated Board, Box Making Machinery, Corrugated Board Making Plant, Die Punching, Cutting, Creasing & Embossing Machine, Hot Foil Stamping Die Cutting... Read More »
- Bag making machinery | Printing and graphics equipment | Paper sorting machinery and equipment | Laying machines...
- Hyderabad
- India
supplyautonomy.com/finopack.cn
An open mouth bagging machine is an automatic filling and sealing machine which fills products into bags up to a specific weight, and closes the bag mouth automatically. Our automatic bagging and... Read More »
- Packaging machinery and equipment | Packaging machinery | Packaging machinery parts
- Hefei
- China