Mga Resulta ng Paghahanap para sa: Air-uuri ng mga serbisyo para sa industriya ng kemikal

Nahanap 30 kumpanya


supplyautonomy.com/univar.fr
  • Kemikal - import-export | Protina pagdalisay serbisyo | Sieving ng pastes para sa industriya ng kemikal | Air-uuri ng...
  • Fontenay-sous-Bois
  • France
supplyautonomy.com/sofresidengineering.fr
  • Pipework kontratista, chemical at nuclear maagos system | Pipework install kontratista, kemikal halaman | Pipework...
  • Montigny-le-Bretonneux
  • France
supplyautonomy.com/hosokawamicronlimited.gb
Hosokawa Micron Ltd is your single source for integrated powder processing systems and containment solutions. Our core products and services include particle design for nano technology, size... Basahin Higit pang mga »
  • Naghahalong mabuti at blending teknolohiya consultant engineering | Produksyon ng mga serbisyo, dietary supplements |...
  • Runcorn
  • United Kingdom
supplyautonomy.com/sudarshandhoopp.in
Manufacturers and Exporters of Incense Products like Dhoop, Agarbathi Coils and Cones, Extruded Bambooless Sticks, Incense Sticks, Magical Charcoal Tablets, Pure Natural Agarbatti, Incense Gift Sets... Basahin Higit pang mga »
  • Produksyon ng mga serbisyo, dietary supplements | Pagpuno at packaging serbisyo, solvents at Pandikit, pang-industriya...
  • New Delhi
  • India
supplyautonomy.com/stridesarcolab.in
Manufacturer, Exporters and Importers of Antibiotics, Cephalophins, Nutracentieah, HIV Rearoviral, Vitamins, Soft Gelatin Capsule, Tablet, Liquid Injection, Dry Powder Injection, Oral Solid Dosage... Basahin Higit pang mga »
  • Produksyon ng mga serbisyo, dietary supplements | Blending ng mga gamot | Spray pagpapatayo ng mga gamot | Protina...
  • Bengaluru
  • India
supplyautonomy.com/islandwidemarketingservicespvt.lk
Import & Supply of Industrial Chemicals,Machinery Lab Equipment,Packaging along with the Technological Inputs & Clearing & Forwarding Agents,Export of Coconut based... Basahin Higit pang mga »
  • Pagbawi at pagbabagong-buhay ng mga pabagu-bago ng isip organic compounds (voc) | Protina pagdalisay serbisyo | Sieving...
  • Rajagiriya
  • Sri Lanka
supplyautonomy.com/developpementbernardplasencia.fr
  • Pharmaceutical produksyon engineering consultant | Biochemical engineering consultant | Pagbabagong-buhay para sa mga...
  • Saint-Priest
  • France
supplyautonomy.com/aircontrolsa.es
  • Paglamig ng halaman, bantay-bilangguan proyekto | Produksyon ng mga serbisyo, dietary supplements | Blending ng mga...
  • San Sebastián
  • Espanya
supplyautonomy.com/borgessa.es
  • Grouting, batay plaster | Produksyon ng mga serbisyo, dietary supplements | Kalakal negosyante, raw at goma LaTeX |...
  • Reus
  • Espanya
supplyautonomy.com/azelisfrance.fr
  • Produksyon ng mga serbisyo, dietary supplements | Kemikal - import-export | Blending ng mga gamot | Spray pagpapatayo...
  • Paris
  • France
supplyautonomy.com/ktronfrance.fr
  • Produksyon ng mga serbisyo, dietary supplements | Pagpuno at packaging serbisyo, solvents at Pandikit, pang-industriya...
  • Croissy-sur-Celle
  • France
supplyautonomy.com/lgobbisrl.it
  • Produksyon ng mga serbisyo, dietary supplements | Pagbabagong-buhay ng mga catalysts | Pagbabagong-buhay para sa mga...
  • CAMPO LIGURE (GE)
  • Italya
supplyautonomy.com/alchimexsa.ro
  • Produksyon ng mga serbisyo, dietary supplements | Blending ng mga gamot | Spray pagpapatayo ng mga gamot | Protina...
  • Bucharest
  • Romania
supplyautonomy.com/nopcopapertechnologysl.es
  • Produksyon ng mga serbisyo, dietary supplements | Pagbawi ng mga kuwadro at taba mula maagos at basura tubig | Blending...
  • Terrassa
  • Espanya
supplyautonomy.com/corquimiaindustrialsl.es
  • Produksyon ng mga serbisyo, dietary supplements | Importer-exporters, kemikal | Pagbabagong-buhay ng mga catalysts |...
  • Esplugues de Llobregat
  • Espanya
supplyautonomy.com/irelspolsro.cz
  • Produksyon ng mga serbisyo, dietary supplements | Packaging mga serbisyo para sa transportasyon ng mga kemikal |...
  • Miroslav
  • Czech Republic
supplyautonomy.com/coger.fr
  • Sieving ng pastes para sa industriya ng kemikal | Air-uuri ng mga serbisyo para sa industriya ng kemikal | Calcining ng...
  • PARIS 15
  • France
supplyautonomy.com/toshniwalsystemsandinstrumentsprivatelimited.in
Manufacturers, Exporters & Importers Of Oval Gear Meter, Turbine Flow Meter, Vortex Meter, Density Meter, Cone Meter, Clamp On Ultrasonic Meter, Magnetic Inductive Flow Sensor, Flow Computer,... Basahin Higit pang mga »
  • Produksyon ng mga serbisyo, dietary supplements | Blending ng mga gamot | Spray pagpapatayo ng mga gamot | Protina...
  • Chennai
  • India
supplyautonomy.com/ajantachemicals.in
Manufacturers and Exporters of Agro Chemicals, Organic Chemicals and Inorganic Chemicals.
  • Produksyon ng mga serbisyo, dietary supplements | Blending ng mga gamot | Spray pagpapatayo ng mga gamot | Protina...
  • New Delhi
  • India
supplyautonomy.com/lessonia.fr
  • Produksyon ng mga serbisyo, dietary supplements | Pagbawi at pinipino ng pang-industriya ng langis | Pagbawi at...
  • ST THONAN
  • France
supplyautonomy.com/ikpindustrikemiproduktionviaredab.se
  • Produksyon ng mga serbisyo, dietary supplements | Blending ng mga gamot | Spray pagpapatayo ng mga gamot | Protina...
  • Hovås
  • Sweden
supplyautonomy.com/alliancechimiealgeriespa.dz
  • Produksyon ng mga serbisyo, dietary supplements | Pangkalahatang broker, internasyonal na kalakalan | Transit...
  • Rouiba
  • Algeria
supplyautonomy.com/gremountinternational.cn
Mainly exports food additives, feed additives, flavours, sweeteners, nutrition, organic chemicals, amino acid, plant extracts, medicine intermediates and chemicals for water treatment. import whey... Basahin Higit pang mga »
  • Protina pagdalisay serbisyo | Air-uuri ng mga serbisyo para sa industriya ng kemikal | Calcining ng kemikal |...
  • Beijing
  • China
supplyautonomy.com/amcolmineralseuropelimited.gb
Mineral & chemical processing company Minerial processers
  • Air-uuri ng mga serbisyo para sa industriya ng kemikal | Tubig paggamot mga produkto | Strippers at abrasives, kemikal...
  • Winsford
  • United Kingdom
supplyautonomy.com/kamikainstrumentsscdorotakaminskastanislawkaminski.pl
  • Air-uuri ng mga serbisyo para sa industriya ng kemikal | Calcining ng kemikal | Pagpapaputi mga serbisyo para sa...
  • Warszawa
  • Poland
supplyautonomy.com/dongahconstructionindco.kr
Manufacture & Export of Civil Engineering Work, Architectural Work, Building Construction, Bolt & Nut, Jaw Crusher
  • Meteorolohiko impormasyon sa mga serbisyo para sa mga platform ng langis | Air-uuri ng mga serbisyo para sa industriya...
  • Seoul
  • South Korea
supplyautonomy.com/fsfahrerschmiedegmbhniederlassunghamburg.de
  • Air-uuri ng mga serbisyo para sa industriya ng kemikal | Pagpapatayo ng mga produkto ng kemikal | Calcining ng kemikal...
  • Hamburg
  • Germany
supplyautonomy.com/geosigmaab.se
  • Heokimika consultant | Air-uuri ng mga serbisyo para sa industriya ng kemikal | Rock pagbuo at pangunahing pagtatasa...
  • Uppsala
  • Sweden