Loading...
Резултати од пребарувањето за: Работењето на спортски и рекреативни објекти
Најде 13336 компанииsupplyautonomy.com/curemedspa.us
WE ARE THE #1 NON-INVASIVE COSMETIC MEDICAL PRACTICE AND WELLNESS CENTER IN MYSTIC, CT.
Our priority is to create an experience for your body, mind, and spirit, with a results-driven treatment plan... Прочитај повеќе »
- Услуги на минерални бањи
- Mystic
- Соединети Американски Држави
supplyautonomy.com/gettinlippywithbritaesthetics.us
Gettin Lippy With Brit Aesthetics is passionate about helping patients be their best selves by enhancing their natural beauty and slowing down the clock with botox-neurotoxin, Dysport, Xeomin,... Прочитај повеќе »
- Услуги на минерални бањи
- Fort Worth
- Соединети Американски Држави
supplyautonomy.com/aesthetify.us
At Aesthetify, we're dedicated to providing medical care that's as unique as you are. We recognize that each person is a unique canvas, shaped by their history, lifestyle, and aspirations.... Прочитај повеќе »
- Услуги на минерални бањи
- Watchung
- Соединети Американски Држави
supplyautonomy.com/quiktox.us
Welcome to QUIKTOX™ Injection Studio, where we revolutionize the way Tox treatments are delivered. Founded and funded by industry veterans, our clinic is built upon a foundation of deep domain m... Прочитај повеќе »
- Услуги на минерални бањи
- Costa Mesa
- Соединети Американски Држави
supplyautonomy.com/foreveryoungmedispasugarlandtx.us
Forever Young Medi Spa is your one-stop Medical Spa for all your beauty and wellness needs. Our team of licensed professionals is dedicated to helping you look and feel your best, using only the most... Прочитај повеќе »
- Услуги на минерални бањи
- Sugar Land
- Соединети Американски Држави
supplyautonomy.com/allureaesthetics.us
At Allure, we like to understand your beauty & aesthetic goals so we can guide you to the right services and products. We offer monthly specials which are shared on both social media & on our... Прочитај повеќе »
- Услуги на минерални бањи
- Great Falls
- Соединети Американски Држави
supplyautonomy.com/dolcevidamedicalsparidgefield.us
Dolce Vida Med Spa is a full-service medical aesthetics resource serving men and women from in and around Greenwich, Westport, Ridgefield, Trumbull, and Hamden, Connecticut. Under the leadership of... Прочитај повеќе »
- Услуги на минерални бањи
- Ridgefield
- Соединети Американски Држави
supplyautonomy.com/inglofaceandbodysculpting.us
At IN•GLO™ Face and Body Sculpting Med Spa we have certainly done our best to perfect them. Dedicating ourselves to the craft, we maintain the knowledge necessary to demonstrate our services to those ... Прочитај повеќе »
- Услуги на минерални бањи
- New York
- Соединети Американски Држави
supplyautonomy.com/rajeunirmedical.us
At Rajeunir Medical, Seattle's premier aesthetics & wellness center & med spa, Dr. Mona Shawky's expertise for personalized, concierge-level care prioritizes your health and... Прочитај повеќе »
- Услуги на минерални бањи
- Mercer Island
- Соединети Американски Држави
supplyautonomy.com/austexwellnessandmedicalspa2.us
AUSTEX is a top Medical Spa in Austin, TX. We service all of Austin including, Lakeway, Bee Cave, Spicewood, Four Points, Westlake, and Dripping Springs. We are one of the only Medical Spas to offer... Прочитај повеќе »
- Услуги на минерални бањи
- Lakeway
- Соединети Американски Држави
supplyautonomy.com/pausepainwellness3a.us
Mississippi's #1 Medical Card Referral Clinic with multiple statewide locations to serve you.
We do more than get you approved for your medical cannabis card. Pause Pain & Wellness is... Прочитај повеќе »
- Медицински третмани и терапии
- Olive Branch
- Соединети Американски Држави
supplyautonomy.com/priveosanté.ca
Priveo Santé was born out of a vision to create a welcoming, comfortable and warm environment for everyone who walks through our doors. We are aware that your health is a priority, which is why we ... Прочитај повеќе »
- Медицински третмани и терапии
- Laval
- Канада
supplyautonomy.com/upliftaesthetics.us
Let us help you feel like you again! We offer Botox, Filler, and skin care solutions to help you regain your sense of self, increase self confidence, and enhance or restore your natural beauty.... Прочитај повеќе »
- Услуги на минерални бањи
- Oakdale
- Соединети Американски Држави
supplyautonomy.com/puredayspa.ca
We are a full service spa located in beautiful Mattick's Farm. Our staff of friendly and licensed estheticians cover all your spa needs. Our treatments include facials for all skin types,... Прочитај повеќе »
- Услуги на минерални бањи
- Victoria
- Канада
supplyautonomy.com/signatureaestheticsivlounge.us
Our practitioners are board certified and proficient at the art of facial rejuvenation. Our services include injectables such as Botox and Dysport, Dermal Fillers, Micro-needling, Chemical Peels, and... Прочитај повеќе »
- Услуги на минерални бањи
- Liberty Hill
- Соединети Американски Држави
supplyautonomy.com/colorectalclinicofmichigan1.us
Dr. Alame is board certified in general surgery and specializes in advanced colorectal surgical procedures. He earned his medical degree from the prestigious University of Miami in Florida. After... Прочитај повеќе »
- Медицински третмани и терапии
- Saint Clair Shores
- Соединети Американски Држави
supplyautonomy.com/drsharonaesthetics.us
Dr. Sharon Aesthetics Medical Spa offers a wide variety of beauty enhancing procedures such as neurotoxins, dermal fillers, microneedling, Vampire facials/facelifts, “O” shot, “P” shot, hair restora... Прочитај повеќе »
- Услуги на минерални бањи
- Houston
- Соединети Американски Држави
supplyautonomy.com/elevatemedandaesthetics.us
Elevate Medical and Aesthetic Spa is a place to be for all you aesthetic needs. We provide complete medical and wellness care in a peaceful environment that combines services offered in spa with... Прочитај повеќе »
- Услуги на минерални бањи
- Plantation
- Соединети Американски Држави
supplyautonomy.com/adoromedicalspa1.us
Over the years, Dr. Pacheco has established a practice that takes pride in first-rate care, comprehensive rejuvenation, and in the satisfaction and comfort of it's patients. Dr. Pacheco's... Прочитај повеќе »
- Услуги на минерални бањи
- Severna Park
- Соединети Американски Држави
supplyautonomy.com/bluedivine.us
Blue Divine is an Atlanta med spa focusing on all skin tones with dual wavelength YAG & Alexandrite laser hair removal, & Aerolase YAG laser facials, Cynosure signature laser facials, medical... Прочитај повеќе »
- Услуги на минерални бањи
- Atlanta
- Соединети Американски Држави
supplyautonomy.com/vivantaestheticswellness.us
We believe that everyone is naturally beautiful and unique, but we also understand that most people have insecurities that can hold them back in their life. Our purpose is to enhance your natural... Прочитај повеќе »
- Услуги на минерални бањи
- Itasca
- Соединети Американски Држави
supplyautonomy.com/afcurgentcaresouthcharlotte.us
Urgent Care South Charlotte. Located On the North Corner of Johnston Road Plaza, in front of Food Lion Grocery Store. AFC Urgent Care treats everything from cuts and bruises to fractures and colds... Прочитај повеќе »
- Медицински третмани и терапии | Медицинска нега за болните
- Charlotte
- Соединети Американски Држави
supplyautonomy.com/veritareset.mx
Verita Reset is an integrative medical treatment center in Tijuana, Mexico specializing in the holistic treatment of chronic Lyme Disease, rheumatoid arthritis, lupus, mold toxicity, and other... Прочитај повеќе »
- Медицински третмани и терапии
- Tijuana
- Мексико
supplyautonomy.com/macleyfamilypracticeandwalkinclinic.us
Whether it is a minor sprain, fever, ear pain, or a complex medical problem, we are here for you. Our friendly and competent staff, including board-certified physicians, utilizes the latest medical... Прочитај повеќе »
- Клиника | Медицински третмани и терапии | Медицински консултации | Лекари...
- Duluth
- Соединети Американски Држави
supplyautonomy.com/texasveinexperts.us
Our team at Frisco consists of highly trained vascular specialists that diagnose and treat venous diseases including venous reflux using minimally-invasive techniques for more than 10 years. Take the... Прочитај повеќе »
- Медицински третмани и терапии
- Frisco
- Соединети Американски Држави
supplyautonomy.com/dankrevolutionstore11.nl
Dank Revolution store provides visitors with reviews of the best medical cannabis strains.
Explore the latest cannabis news, Dank Revolution store tips, education and more from Dank Revolution... Прочитај повеќе »
- Медицински третмани и терапии
- Capelle aan den IJssel
- Холандија
supplyautonomy.com/hermannaestheticswellness.us
Hermann Wellness offers a wide variety of spa services that include facials, peels, microdermabrasion treatments. A facial is a great way to take care of your skin, especially when coupled with a... Прочитај повеќе »
- Медицински третмани и терапии
- St. Petersburg
- Соединети Американски Држави
supplyautonomy.com/globalmedicalcare.gb
For the past 5 years, Global Medical Care has been providing affordable high-standard medical treatments for patients from Switzerland and Europe. The Firm’s reputation has been built on an u... Прочитај повеќе »
- Медицински третмани и терапии
- South Wimbledon
- Велика Британија
supplyautonomy.com/nuhairmedical.ca
NuHair Medical offers state of the art surgical and non-surgical hair restoration for treatment of both female pattern baldness and male androgenic alopecia. Treatments offered include Follicular... Прочитај повеќе »
- Медицински третмани и терапии
- Vancouver
- Канада
supplyautonomy.com/mdproactive.us
MDPROACTIVE is an online medical provider that aims to treat minor medical ailments for patients via the internet or smartphone, when they do not have convenient access to their primary care... Прочитај повеќе »
- Медицински третмани и терапии
- Naperville
- Соединети Американски Држави