Search Results for: Shërbimet e pastrimit proteinave
Kompanitë e gjetura 35Listimet e Preferuar që lidhen me: Shërbimet e pastrimit proteinave
supplyautonomy.com/librawpharma.in
Manufacturers and Exporters Of Pharmaceutical Products Like Tablets Including Polyoxyl 40 Hydrogenated Castor Oil, Solvent Enteric Coating Polymer, Lake Colours Aqueous Enteric Coating Polymers,... Lexo më shumë »
- Përzierja e farmaceutike | Llak tharje e farmaceutike | Shërbimet e pastrimit proteinave | Nxjerrja dhe pastrimi i h...
- New Delhi
- Indi
supplyautonomy.com/hrsprocesssystems.in
Manufacturers, Exporters & Importers Of Wide Range Of Heat Exchangers, ECOFLUX* Corrugated Tube Heat Exchanger, Shell And Tube Heat Exchanger, UNICUS® Scraped Surface Heat Exchanger, ... Lexo më shumë »
- Shërbimet e prodhimit, shtojcave dietike | Përzierja e farmaceutike | Llak tharje e farmaceutike | Shërbimet e pa...
- Pune
- Indi
supplyautonomy.com/univar.fr
- Kimikatet - import-eksport | Shërbimet e pastrimit proteinave | Sieving i pastave për industrinë kimike | Klasifikimit s...
- Fontenay-sous-Bois
- Francë
supplyautonomy.com/kellyservices.fr
- Konsulentët meteorologjike | Konsulentët energji avulli | Konsulentët Gjeofizikë | Hidrogjeologjia konsulentët | Kons...
- Clichy
- Francë
supplyautonomy.com/sofresidengineering.fr
- Kontraktuesit gypave, kimike dhe sistemet bërthamore rrjedhës | Kontraktuesit instalimin Gypat, fabrikë kimike | Ko...
- Montigny-le-Bretonneux
- Francë
supplyautonomy.com/sudarshandhoopp.in
Manufacturers and Exporters of Incense Products like Dhoop, Agarbathi Coils and Cones, Extruded Bambooless Sticks, Incense Sticks, Magical Charcoal Tablets, Pure Natural Agarbatti, Incense Gift Sets... Lexo më shumë »
- Shërbimet e prodhimit, shtojcave dietike | Plotësimi dhe Packaging shërbimeve, tretës dhe ngjitëse, industriale | Përz...
- New Delhi
- Indi
supplyautonomy.com/stridesarcolab.in
Manufacturer, Exporters and Importers of Antibiotics, Cephalophins, Nutracentieah, HIV Rearoviral, Vitamins, Soft Gelatin Capsule, Tablet, Liquid Injection, Dry Powder Injection, Oral Solid Dosage... Lexo më shumë »
- Shërbimet e prodhimit, shtojcave dietike | Përzierja e farmaceutike | Llak tharje e farmaceutike | Shërbimet e pa...
- Bengaluru
- Indi
supplyautonomy.com/lgobbisrl.it
- Shërbimet e prodhimit, shtojcave dietike | Rigjenerimin e katalizatorëve | Shërbimet e rigjenerimit për aktivizimit të k...
- CAMPO LIGURE (GE)
- Itali
supplyautonomy.com/islandwidemarketingservicespvt.lk
Import & Supply of Industrial Chemicals,Machinery Lab Equipment,Packaging along with the Technological Inputs & Clearing & Forwarding Agents,Export of Coconut based... Lexo më shumë »
- Rimëkëmbjes dhe rigjenerimi i komponimeve organike të paqëndrueshme (VOC) | Shërbimet e pastrimit proteinave | Sieving e...
- Rajagiriya
supplyautonomy.com/developpementbernardplasencia.fr
- Konsulentëve farmaceutike inxhinieri e prodhimit | Konsulentët inxhinieri biokimike | Shërbimet e rigjenerimit për akt...
- Saint-Priest
- Francë
supplyautonomy.com/aircontrolsa.es
- Bimore ftohjes, projektet e gardian | Shërbimet e prodhimit, shtojcave dietike | Përzierja e farmaceutike | Llak tharje ...
- San Sebastián
- Spanjë
supplyautonomy.com/borgessa.es
- Grouting, suva të bazuar | Shërbimet e prodhimit, shtojcave dietike | Tregtarët mall, Goma të para dhe latex | Tre...
- Reus
- Spanjë
supplyautonomy.com/azelisfrance.fr
- Shërbimet e prodhimit, shtojcave dietike | Kimikatet - import-eksport | Përzierja e farmaceutike | Llak tharje e f...
- Paris
- Francë
supplyautonomy.com/ktronfrance.fr
- Shërbimet e prodhimit, shtojcave dietike | Plotësimi dhe Packaging shërbimeve, tretës dhe ngjitëse, industriale | Përz...
- Croissy-sur-Celle
- Francë
supplyautonomy.com/hosokawamicronlimited.gb
Hosokawa Micron Ltd is your single source for integrated powder processing systems and containment solutions. Our core products and services include particle design for nano technology, size... Lexo më shumë »
- Përzierjen dhe përzierja konsulentë Inxhinieri Teknologji | Shërbimet e prodhimit, shtojcave dietike | Përzierja e farm...
- Runcorn
- Mbretëria e Bashkuar
supplyautonomy.com/irelspolsro.cz
- Shërbimet e prodhimit, shtojcave dietike | Shërbimet e paketimit për transportimin e kimikateve | Përzierja e far...
- Miroslav
- Republika e Çekisë
supplyautonomy.com/corquimiaindustrialsl.es
- Shërbimet e prodhimit, shtojcave dietike | Importuesit-eksportuesit, kimikate | Rigjenerimin e katalizatorëve | S...
- Esplugues de Llobregat
- Spanjë
supplyautonomy.com/nopcopapertechnologysl.es
- Shërbimet e prodhimit, shtojcave dietike | Mbulimi i vajrave dhe yndyrave nga uji rrjedhës dhe mbeturinave | Përzierja e...
- Terrassa
- Spanjë
supplyautonomy.com/ajantachemicals.in
Manufacturers and Exporters of Agro Chemicals, Organic Chemicals and Inorganic Chemicals.
- Shërbimet e prodhimit, shtojcave dietike | Përzierja e farmaceutike | Llak tharje e farmaceutike | Shërbimet e pa...
- New Delhi
- Indi
supplyautonomy.com/toshniwalsystemsandinstrumentsprivatelimited.in
Manufacturers, Exporters & Importers Of Oval Gear Meter, Turbine Flow Meter, Vortex Meter, Density Meter, Cone Meter, Clamp On Ultrasonic Meter, Magnetic Inductive Flow Sensor, Flow Computer,... Lexo më shumë »
- Shërbimet e prodhimit, shtojcave dietike | Përzierja e farmaceutike | Llak tharje e farmaceutike | Shërbimet e pa...
- Chennai
- Indi
supplyautonomy.com/alchimexsa.ro
- Shërbimet e prodhimit, shtojcave dietike | Përzierja e farmaceutike | Llak tharje e farmaceutike | Shërbimet e pa...
- Bucharest
- Rumani
supplyautonomy.com/lessonia.fr
- Shërbimet e prodhimit, shtojcave dietike | Rimëkëmbjes dhe rafinimit të naftës industriale | Rimëkëmbjes dhe rigjen...
- ST THONAN
- Francë
supplyautonomy.com/ikpindustrikemiproduktionviaredab.se
- Shërbimet e prodhimit, shtojcave dietike | Përzierja e farmaceutike | Llak tharje e farmaceutike | Shërbimet e pa...
- Hovås
- Suedi
supplyautonomy.com/alliancechimiealgeriespa.dz
- Shërbimet e prodhimit, shtojcave dietike | Brokerat Përgjithshëm, Tregtinë Ndërkombëtare | Tregtarët Transit | Import...
- Rouiba
- Algjeri
supplyautonomy.com/lafayettehill.us
Protica Inc. is a nutritional research firm specializing in the development of capsulized foods (dense nutrition in compact liquid and food forms). Protica manufactures Profect, IsoMetric, Pediagro,... Lexo më shumë »
- Shërbimet e pastrimit proteinave | Proteinë
- Whitehall
- Shtetet e Bashkuara të Amerikës
supplyautonomy.com/protagenag.de
Protagen AG offers a growing number of products and services based on the unique expertise in antibody characterization, high throughput expression, purification of recombinant proteins
- Shërbimet e pastrimit proteinave | Bioteknologji
- Dortmund
- Gjermani
supplyautonomy.com/gremountinternational.cn
Mainly exports food additives, feed additives, flavours, sweeteners, nutrition, organic chemicals, amino acid, plant extracts, medicine intermediates and chemicals for water treatment. import whey... Lexo më shumë »
- Shërbimet e pastrimit proteinave | Klasifikimit shërbimet ajrore për industrinë kimike | Calcining i kimikateve | Zba...
- Beijing
- Kinë
supplyautonomy.com/nzymebiotecgmbh.de
- Shërbimet e pastrimit proteinave | Bioteknologji
- Darmstadt
- Gjermani
supplyautonomy.com/gnc1.us
supplyautonomy.com/thefreshmonkeecolchester.us
Whether you're looking for a nutritious post-workout boost or a tasty treat, our popular shakes like the Antioxidant Berry, Mint Oreo, Mass Strawberry Oats, Maui Colada, and Banana Split are... Lexo më shumë »
- Shërbimet e pastrimit proteinave | Ushqime, diete, për terapive ushqim
- Colchester
- Shtetet e Bashkuara të Amerikës