Search Results for: Sieving of pastes for the chemical industry
Found 34 companiesPreferred listings related to: Sieving of pastes for the chemical industry
supplyautonomy.com/librawpharma.in
Manufacturers and Exporters Of Pharmaceutical Products Like Tablets Including Polyoxyl 40 Hydrogenated Castor Oil, Solvent Enteric Coating Polymer, Lake Colours Aqueous Enteric Coating Polymers,... Read More »
- Blending of pharmaceuticals | Spray drying of pharmaceuticals | Protein purification services | Extraction and...
- New Delhi
- India
supplyautonomy.com/hrsprocesssystems.in
Manufacturers, Exporters & Importers Of Wide Range Of Heat Exchangers, ECOFLUX* Corrugated Tube Heat Exchanger, Shell And Tube Heat Exchanger, UNICUS® Scraped Surface Heat Exchanger, ... Read More »
- Production services, dietary supplements | Blending of pharmaceuticals | Spray drying of pharmaceuticals | Protein...
- Pune
- India
supplyautonomy.com/robinsonwirecloth.gb
Robinson Wire Cloth Ltd are a supplier of all types of filter meshes and materials. Our extensive in-house facilities enable us to manufacture woven mesh screens, tension screens and bonded screens... Read More »
- Sieving of liquids for the chemical industry | Sieving of solids for the chemical industry | Sieving of pastes for the...
- Stoke On Trent
- United Kingdom
supplyautonomy.com/univar.fr
- Chemicals - import-export | Protein purification services | Sieving of pastes for the chemical industry | Air...
- Fontenay-sous-Bois
- France
supplyautonomy.com/sofresidengineering.fr
- Pipework contractors, chemical and nuclear effluent systems | Pipework installation contractors, chemical plant |...
- Montigny-le-Bretonneux
- France
supplyautonomy.com/sudarshandhoopp.in
Manufacturers and Exporters of Incense Products like Dhoop, Agarbathi Coils and Cones, Extruded Bambooless Sticks, Incense Sticks, Magical Charcoal Tablets, Pure Natural Agarbatti, Incense Gift Sets... Read More »
- Production services, dietary supplements | Filling and packaging services, solvents and adhesives, industrial |...
- New Delhi
- India
supplyautonomy.com/lgobbisrl.it
- Production services, dietary supplements | Regeneration of catalysts | Regeneration services for activated carbon |...
- CAMPO LIGURE (GE)
- Italy
supplyautonomy.com/stridesarcolab.in
Manufacturer, Exporters and Importers of Antibiotics, Cephalophins, Nutracentieah, HIV Rearoviral, Vitamins, Soft Gelatin Capsule, Tablet, Liquid Injection, Dry Powder Injection, Oral Solid Dosage... Read More »
- Production services, dietary supplements | Blending of pharmaceuticals | Spray drying of pharmaceuticals | Protein...
- Bengaluru
- India
supplyautonomy.com/islandwidemarketingservicespvt.lk
Import & Supply of Industrial Chemicals,Machinery Lab Equipment,Packaging along with the Technological Inputs & Clearing & Forwarding Agents,Export of Coconut based... Read More »
- Recovery and regeneration of volatile organic compounds (VOC) | Protein purification services | Sieving of liquids for...
- Rajagiriya
- Sri Lanka
supplyautonomy.com/developpementbernardplasencia.fr
- Pharmaceutical production engineering consultants | Biochemical engineering consultants | Regeneration services for...
- Saint-Priest
- France
supplyautonomy.com/hosokawamicronlimited.gb
Hosokawa Micron Ltd is your single source for integrated powder processing systems and containment solutions. Our core products and services include particle design for nano technology, size... Read More »
- Mixing and blending technology engineering consultants | Production services, dietary supplements | Blending of...
- Runcorn
- United Kingdom
supplyautonomy.com/borgessa.es
- Grouting, plaster based | Production services, dietary supplements | Commodity merchants, raw rubber and latex |...
- Reus
- Spain
supplyautonomy.com/azelisfrance.fr
- Production services, dietary supplements | Chemicals - import-export | Blending of pharmaceuticals | Spray drying of...
- Paris
- France
supplyautonomy.com/ktronfrance.fr
- Production services, dietary supplements | Filling and packaging services, solvents and adhesives, industrial |...
- Croissy-sur-Celle
- France
supplyautonomy.com/aircontrolsa.es
- Cooling plant, turnkey projects | Production services, dietary supplements | Blending of pharmaceuticals | Spray drying...
- San Sebastián
- Spain
supplyautonomy.com/ajantachemicals.in
Manufacturers and Exporters of Agro Chemicals, Organic Chemicals and Inorganic Chemicals.
- Production services, dietary supplements | Blending of pharmaceuticals | Spray drying of pharmaceuticals | Protein...
- New Delhi
- India
supplyautonomy.com/alchimexsa.ro
- Production services, dietary supplements | Blending of pharmaceuticals | Spray drying of pharmaceuticals | Protein...
- Bucharest
- Romania
supplyautonomy.com/toshniwalsystemsandinstrumentsprivatelimited.in
Manufacturers, Exporters & Importers Of Oval Gear Meter, Turbine Flow Meter, Vortex Meter, Density Meter, Cone Meter, Clamp On Ultrasonic Meter, Magnetic Inductive Flow Sensor, Flow Computer,... Read More »
- Production services, dietary supplements | Blending of pharmaceuticals | Spray drying of pharmaceuticals | Protein...
- Chennai
- India
supplyautonomy.com/nopcopapertechnologysl.es
- Production services, dietary supplements | Recovery of oils and fats from effluent and waste water | Blending of...
- Terrassa
- Spain
supplyautonomy.com/corquimiaindustrialsl.es
- Production services, dietary supplements | Importers-exporters, chemicals | Regeneration of catalysts | Regeneration...
- Esplugues de Llobregat
- Spain
supplyautonomy.com/irelspolsro.cz
- Production services, dietary supplements | Packaging services for the transportation of chemicals | Blending of...
- Miroslav
- Czech Republic
supplyautonomy.com/swecoeuropedivisionfrance.fr
- Sieving of liquids for the chemical industry | Sieving of solids for the chemical industry | Sieving of pastes for the...
- VALENCIENNES
- France
supplyautonomy.com/coger.fr
- Sieving of pastes for the chemical industry | Air classification services for the chemical industry | Calcining of...
- PARIS 15
- France
supplyautonomy.com/lessonia.fr
- Production services, dietary supplements | Recovery and refining of industrial oil | Recovery and regeneration of...
- ST THONAN
- France
supplyautonomy.com/ikpindustrikemiproduktionviaredab.se
- Production services, dietary supplements | Blending of pharmaceuticals | Spray drying of pharmaceuticals | Protein...
- Hovås
- Sweden
supplyautonomy.com/alliancechimiealgeriespa.dz
- Production services, dietary supplements | General brokers, international trade | Transit traders | Importers with...
- Rouiba
- Algeria
supplyautonomy.com/l.pl
- Sieving of liquids for the chemical industry | Sieving of solids for the chemical industry | Sieving of pastes for the...
- Bytom
- Poland
supplyautonomy.com/fredrikmogensenab.se
- Sieving of liquids for the chemical industry | Sieving of solids for the chemical industry | Sieving of pastes for the...
- Hjo
- Sweden
supplyautonomy.com/jikoshaengineeringcorporation.in
Manufactures and Exporters of Micro Pulverizer, Ball Mill, Impact Pulverizer, Tray Dryer, Fruit Mill, Multi Mill, Ribbon Blender, Stirrer, Reaction Vessel, Screw Conveyor, etc.
- Sieving of liquids for the chemical industry | Sieving of pastes for the chemical industry | Food industry plant and...
- Mumbai
- India
supplyautonomy.com/martongeotechnicalserviceslimited.gb
Geotechnical instrumentation suppliers
- Sieving of liquids for the chemical industry | Sieving of pastes for the chemical industry | Well screens, drilling...
- Bury
- United Kingdom