Loading...
Вынікі пошуку для: Ўпаковачная абсталяванне
Знойдзеныя 4346 кампаніі
supplyautonomy.com/trustarpharmapackingequipment.cn
Wenzhou Trustar Machinery Technology co.,ltd.is located in Ruian, Wenzhou, the capital of packaging and printing. The factory covers an area of about 7000 square meters and the office building area... Больш падрабязна »
- Ўпаковачная абсталяванне
- Wenzhou
- Кітай
supplyautonomy.com/tangshankingvidaprintingmachineryco.cn
The outstanding Tangshan Kingvida Printing Machinery Co., Ltd. is a professional manufacturer of printing and packaging machinery. Located in the central area of Beijing,Tianjin and Tangshan.The... Больш падрабязна »
- Рэзка паперы - абсталяванне | Ўпаковачная абсталяванне | Машыны і абсталяванне для складання і склейвання кардоннай тары...
- Yutian County
- Кітай
supplyautonomy.com/zhejiangruianyongtaipackingmachinerymanufactureco.cn
Zhejiang Ruian Yongtai Packing Machinery Manufacture Co., Ltd is specialized in producing complete sets of flexible packaging equipment and has a long history. We specially produce various plastic... Больш падрабязна »
- Механізм вырабу сумкі | Часткі машыны вырабу сумкі | Друкаваныя машыны | Абсталяванне для вытворчасці тары і ўпакоўкі з ...
- Wenzhou
- Кітай
supplyautonomy.com/guangdongqishengmachineryco.cn
supplyautonomy.com/lindumpackaging1.gb
We analyse what constraints are preventing our customers from achieving optimum efficiency. We know that they need the right products, in the right place, at the right time.
Production Can’t Stop ... Больш падрабязна »
- Навуковыя прамысловыя даследаванні і доследна-канструктарскія распрацоўкі, паслугі кансультантаў па ўпакоўцы і пакавальн...
- Stallingborough, North East Lincolnshire
- Велікабрытанія
supplyautonomy.com/soonkpackagingmachine.cn
Foshan Soonk Packaging Machine Co., Ltd. is a professional advanced enterprise engaged in packaging machine research and development, design, production, sales and maintenance.
- Ўпаковачныя машыны і абсталяванне былыя ва ўжыванні (second-hand) | Машыны для загортваньня і запячатвання | Упакоўка і ...
- Foshan
- Кітай
supplyautonomy.com/tubitexspa.it
supplyautonomy.com/antoniodominicifratellicostruzionimeccanichesrl.it
Production of machinery for the baking and food industries. Robotized systems for handling, chocolate egg wrappers, chocolate coin wrappers, nougat cookers and cutters, bakery machinery, automatic... Больш падрабязна »
- Тестомесилки для выпечкі хлеба і кандытарскіх вырабаў | Машыны і абсталяванне месильное і змешваюць для кандытарскага вы...
- Perugia
- Італія
supplyautonomy.com/bidllc.ua
BID company - Pasta and packaging equipment manufacture
Dear Sirs!
The distinctive mark of our company is a wide range of pasta, drying and packaging equipment, which allows to produce pasta... Больш падрабязна »
- Тестомесилки для выпечкі хлеба і кандытарскіх вырабаў | Ўстаноўкі і абсталяванне для харчовай прамысловасці не ўказаныя ...
- Dnepropetrovsk
- Украіна
supplyautonomy.com/rakshapackaging.in
The company formed in the year 1976 as a-class ancillary suppliers diversified into the field of packaging by the name of Raksha Packaging in the year 1994.
The growth in packaging industry is far... Больш падрабязна »
- Кантэйнеры, стэлажы з пластыка для дастаўкі піцы на дом | Плёнкі пластыкавыя (палімерныя) для ўпакоўкі харчовых прадукта...
- Faridabad
- Індыя
supplyautonomy.com/riddhipharmamachinery.in
Manufacturers and Exporters of Pharmaceutical Machineries. Our multitude of products include Pharmaceutical Machinery, Tablet Press Machine, Rotary Tablet Press Machine, Fluid Bed Dryer, Tray drier,... Больш падрабязна »
- Ўстаноўкі і абсталяванне для харчовай прамысловасці не ўказаныя ў іншым месцы | Машыны Экструзійныя, экструдары для фарм...
- Mumbai
- Індыя
supplyautonomy.com/acmemachineryindiapvt.in
Acme Machinery (India) Pvt. Ltd. is a professionally managed organization accredited for manufacturing and exporting of Paper Board Printing, Packaging and Converting Machineries since... Больш падрабязна »
- Машыны картоноделательные круглосеточные бесперапыннага дзеяння | Формы круглосеточные для вытворчасці кардона | Машыны ...
- Mumbai
- Індыя
supplyautonomy.com/gdspa.it
G.D is the world's leading cigarette production and packaging machinery constructor. Its vast array of solutions makes G.D. the only company in a position to offer complete high-speed lines.
- Машыны ўвільгатняюць для абутковай вытворчасці | Ўстаноўкі для астуджэння нарэзанага тытуню для вытворчасці цыгарэт і па...
- Bologna
- Італія
supplyautonomy.com/reconmachinetoolspvt.in
Recon is a leading manufacturer of Plant and Machinery for Metal Cans, Metal Closures Steel Drums, also complete packaging lines for powder, liquid paste in metal containers.
Established in the... Больш падрабязна »
- Машыны і абсталяванне для вырабу састаўных (зборных) кансервавых слоікаў | Канвееры для слоікаў і накрывак для кансервав...
- Mumbai
- Індыя
supplyautonomy.com/assopackmachines.in
We have created a niche among quality-oriented corrugators. Our name inspires confidence not only among Indian corrugators but it is known for its reliability of its products in foreign markets... Больш падрабязна »
- Машыны намотваецца, размотваць і перамотваць рулоны для вытворчасці паперы | Машыны шматаперацыйныя намотваецца, перамот...
- Ahmedabad
- Індыя
supplyautonomy.com/gangasinghengineeringpvt.in
ESSGEE Exports is a proprietary concern established in 1993 and are very strong in exporting machinery which are mainly used in tin container industry, packaging industries and having vast knowledge... Больш падрабязна »
- Інструменты для будаўнічых работ | Ўстаноўкі і абсталяванне для харчовай прамысловасці не ўказаныя ў іншым месцы | Бурэн...
- Mumbai
- Індыя
supplyautonomy.com/apsaraengineers.in
We the manufacturers and exporters of all kinds of textile related machinery, we are specialist in polyfill opening machinery, pillow packing machinery and blowfill machines in nominal cost.
We... Больш падрабязна »
- Бабіны, шпулькі, шпулі з пластыка для тэкстыльнага абсталявання | Гільзы з пластыка прадзільных для тэкстыльнага абсталя...
- Coimbatore
- Індыя
supplyautonomy.com/foshancitycoretamppackingmachineryco.cn
Foshan Coretamp Packaging Machinery Co.,Ltd. is located in China Machinery Center - Foshan city, takes 30 minutes to Guangzhou and 2 hours to Shenzhen/Hong Kong. We are a leading manufacturer of all k... Больш падрабязна »
- Ўпаковачная абсталяванне
- Foshan
- Кітай
supplyautonomy.com/excellpacks.in
Welcome
Empowering people through prosperity and helping them create wealth have been the mission of VK Engineering & Company since 2000
VK Engineering & Company and heir... Больш падрабязна »
- Упакоўка і ўпаковачныя матэрыялы - тэхніка і абсталяванне | Ўпаковачныя машыны і абсталяванне | Ўпаковачная абсталяванне...
- Coimbatore, Tamil Nādu
- Індыя
supplyautonomy.com/cooltechenterprises.in
A renowned name in the domain of Cooling Pads, ABS Ductable Cooling Machine, Desert/Room Coolers, etc., Cool Tech Enterprises has been offering quality to the clients. Combining technology and wide... Больш падрабязна »
- Агенты па прадуктах бяспекі | Перакладная друк | Паслугі ліццёвага фармавання металаў | Ізаляцыйныя матэрыялы | Спружыны...
- Amravati
- Індыя
supplyautonomy.com/chamundaindustries.in
We are pleased to introduce ourselves as one of the leading Exporters, Manufacturers , Stockists Supplier of stainless steel item,ferrous non-ferrous metal which are required by your company in... Больш падрабязна »
- Агенты па прадуктах бяспекі | Перакладная друк | Паслугі ліццёвага фармавання металаў | Ізаляцыйныя матэрыялы | Спружыны...
- Mumbai
- Індыя
supplyautonomy.com/preciousmineralprocessingsystemspvt.in
CHITRA PHARMA MACHINERY
PRECIOUS FAB-CAST PVT. LTD. , the parent company of CHITRA PHARMA MACHINERY-an ISO 9001: 2000 company is the designer, developer, manufacturer and exporter of various... Больш падрабязна »
- Абсталяванне для ачысткі | Ўстаноўкі і абсталяванне для харчовай прамысловасці не ўказаныя ў іншым месцы | Бурэнне свідр...
- Ahmedabad
- Індыя
supplyautonomy.com/kusodalamuthucopvt.in
Bharath Paper Conversions are manufacturers and exporters of high quality Paper Cones, Paper Tubes, Paper Cores, Edge Protectors, Composite Cans and Pulp Moulded Products. Established in 1984, the... Больш падрабязна »
- Паддоны, латкі тарныя з фібравы кардона | Тубы з паперы і фібравы кардона | Тубы навитые з паперы і фібравы кардона | Ту...
- Coimbatore
- Індыя
supplyautonomy.com/seniorprintpackmachineryco.in
Manufacturers & Exporters Of Corrugated Board, Box Making Machinery, Corrugated Board Making Plant, Die Punching, Cutting, Creasing & Embossing Machine, Hot Foil Stamping Die Cutting... Больш падрабязна »
- Механізм вырабу сумкі | Абсталяванне для друку і дызайну графічнага | Машыны і абсталяванне для сартавання, разбраковки ...
- Hyderabad
- Індыя
supplyautonomy.com/finopack.cn
An open mouth bagging machine is an automatic filling and sealing machine which fills products into bags up to a specific weight, and closes the bag mouth automatically. Our automatic bagging and... Больш падрабязна »
- Ўпаковачныя машыны і абсталяванне | Ўпаковачная абсталяванне | Часткі машыны ўпакоўкі...
- Hefei
- Кітай