Mga Resulta ng Paghahanap para sa: Packaging machine

Nahanap 7631 kumpanya


supplyautonomy.com/pentagonmarketing.in
Available in various dimensions, specifications, capacities, efficiency, etc, packaging machinery find applications in various industries like chemical, marine, food, etc. Pentagon Marketing is... Basahin Higit pang mga »
  • Mga Printer, kunan ng larawan | Marker Panulat | Pandikit at tape | Packaging makinarya
  • Kochi
  • India
supplyautonomy.com/taisunmachinery.tw
Tai sun machinery Co., ltd has been concentrating on the manufacture of the tissue paper converting machine since 1970. Now the "tai sun" brand has successfully exported A big quantity of... Basahin Higit pang mga »
  • Towel sa paggawa ng mga makina | Packaging makinarya
  • Taipei
  • Taiwan
supplyautonomy.com/iterrainintlenterprisesco.tw
In the manufacture of those machines we use the most advanced modern techniques. We take pride in having offered the overseas markets products of unsurpassed quality and appearance for the 27 years.... Basahin Higit pang mga »
  • Kapeng barako, java | Iba pang ginamit makinarya | Packaging makinarya
  • Taichung
  • Taiwan
supplyautonomy.com/masaelimachinemanufacturing.ir
Masaeli Industry Machinery is a leading company is Iran`s packing industry founded in 1983.Our main products include pillow packing machines that are suitable for packing all of things in different... Basahin Higit pang mga »
  • Packaging makinarya | Packaging linya
  • Esfahan
  • Iran
supplyautonomy.com/ptsancoindonesia.id
Sanco international based in Jakarta, Indonesia is a marketing arms company that owns an exclusive right to promote and to distribute end products from manufacturer of confectionery products in... Basahin Higit pang mga »
  • Capsule pagpuno machine | Packaging makinarya
  • Jakarta
  • Indonesia
supplyautonomy.com/baodingjialifoodmachine.cn
Established in 1998, Baoding Jiali Food Machine Co.,ltd is a professional manufacturer engaged in research, development, production, sale and service of all kinds of food machines. Excellent... Basahin Higit pang mga »
  • Pagkain industriya halaman at equipment Nes | Packaging makinarya
  • Baoding
  • China
supplyautonomy.com/zhejiangruianyongxinmachineryfactory.cn
Ruian Yongxin Machinery Factory is located in Ruian, Zhejiang province, the famous City of Packaging Machinery in China. It always devotes itself to researching and developing packaging or... Basahin Higit pang mga »
  • Iba pang mga pharmaceutical makinarya | Packaging makinarya
  • Ruian
  • China
supplyautonomy.com/zhangjiagangkingstepmachineryco.cn
Our quality products are: Pure/Mineral water production lines Carbonated drink production lines; Fruit juice production lines Tea drink production lines Soy milk and protein drink production... Basahin Higit pang mga »
  • Purong tubig | Packaging makinarya
  • Suzhou
  • China
supplyautonomy.com/nissionfoodmachinerycorporation.cn
Qingdao Nissin Food Machinery Co., Ltd. is a Sino-Japanese joint venture established in 1989. Our company applies complete Japanese technology, blueprints and components and works together with... Basahin Higit pang mga »
  • Snack makinarya | Packaging makinarya
  • Qingdao
  • China
supplyautonomy.com/hbfpt.cn
Our company originates at the beginning of the 1990. Our predecessor is the Shijjiazhuang Changan Stainless Steel Plant, with the registered capital of 1,800,000 and a staff of 70 people. Our... Basahin Higit pang mga »
  • Pagkain industriya halaman at equipment Nes | Iangat mga talahanayan | Packaging makinarya | Staples, wire
  • Shijiazhuang
  • China
supplyautonomy.com/guangzhouhaochiwoodworkingmachineryco.cn
Guangzhou JianChi Woodworking Machinery Co., Ltd. locates in ShaWan Town, Panyu Area, Guangzhou City. We have been insisting on the aim of "survive with quality and develop with... Basahin Higit pang mga »
  • Packaging makinarya | Woodworking kagamitan
  • Guangzhou
  • China
supplyautonomy.com/greatelectricsmachineco.cn
Since our establishment in 1989, Great-Electrics Machine Co., Ltd. has been the leading manufacturer in the thermoforming machine industry in China. We have a strong research and development team to... Basahin Higit pang mga »
  • hinang kagamitan | Plastic welders | Packaging makinarya | Egg trays
  • Guangzhou
  • China
supplyautonomy.com/jayengineeringcombine.in
Standard spares and machineries for soap, detergent, chemicals HVAC Plants JAY ENGINEERING... Basahin Higit pang mga »
  • Packaging makinarya
  • Ahmedabad
  • India
supplyautonomy.com/bossengineeringcompany.in
Backed by industry experience of about a decade, we are engaged in manufacturing a completely automatic range of machines used in filling, capping, and labeling of bottles and containers. Our range... Basahin Higit pang mga »
  • Packaging makinarya | Pharmaceutical packaging machine | Iba pang mga packaging mga materyales
  • Ahmedabad
  • India
supplyautonomy.com/shreejipharmatech.in
About Us Shreeji Pharmatech is one of the pioneering manufacturers of a wide range of Pharmaceutical Machineries like Dry Injectable Powder Filling Machine, Semi-automatic Dry Injectable Powder... Basahin Higit pang mga »
  • Iba pang mga hinabi makinarya | Packaging makinarya
  • Ahmedabad
  • India
supplyautonomy.com/masterfil.gb
The Adelphi Group of Companies has served customers all over the world for over 60 years. Our products range form simple stainless steel vessels to complete turnkey filling and capping lines, all... Basahin Higit pang mga »
  • Packing at packaging - makinarya at kagamitan | Drums, pails at barrels
  • Aylesbury
  • United Kingdom
supplyautonomy.com/susmatexmachinery.in
Dear Visitors and customers, First of all, we would like to tell thanks to visitors and customers who visiting our website, so we are greatly pleased to introduce our company and our products to... Basahin Higit pang mga »
  • Puntas machine | Packaging makinarya
  • Ahmedabad
  • India
supplyautonomy.com/omchamundaenterprises.in
A om chamunda enterprisesis one of the leading manufacturer, exporter and supplier of packaging machine from India. Designed for efficient operation to meet the varying requirements of different... Basahin Higit pang mga »
  • Capsule pagpuno machine | Packaging makinarya
  • Mumbai
  • India
supplyautonomy.com/shrivinayakpackagingmachinepvt.in
Incorporated in the year 2000, Shri Vinayak Print-Pack is a leading importer and supplier of packaging machines. The range includes semi / fully automatic packaging machines, strapping machines,... Basahin Higit pang mga »
  • Packaging makinarya | Matangkad at malusog
  • New Delhi
  • India
supplyautonomy.com/labhprojectspvt.in
Welcome to Labh Group! Labh Group of Companies is a fast growing, well- recognized and an ISO 9001:2008 certified, Indian business group of global repute having presence in more than 100 countries... Basahin Higit pang mga »
  • Kanin bag | Packaging makinarya | Matangkad at malusog
  • Ahmedabad
  • India
supplyautonomy.com/rubyenterprise.in
Jaw crusher, complete crushing plant screening plant
  • Well-pagbabarena makinarya | Ginamit pagmimina makinarya | Packaging makinarya
  • Hooghly
  • India
supplyautonomy.com/brintexsalescorporation.in
Unicon Exports and Imports, is an acknowledged manufacturer and supplier of Pharmaceutical machines for different pharmaceutical sections viz. Granulation section, Liquid Section, Ointment Section... Basahin Higit pang mga »
  • salamin processing machinery | Capsule pagpuno machine | Packaging makinarya | Laboratory babasagin & equipment
  • New Delhi
  • India
supplyautonomy.com/relianceenterprise.in
Offering a wide range of Food Processing & Bakery Equipments such as Tomato Ketchup machine, Single Door Deck Oven, Planetary mixer, Spiral mixer, Rotary rack Oven, Tray Dryer, Vacuum Bottle... Basahin Higit pang mga »
  • Pagkain industriya halaman at equipment Nes | Machine tool para sa nagpapaikut-ikot metal | Packaging makinarya |...
  • Kolkata
  • India
supplyautonomy.com/qingdaothinrawoodworkingmachineryfactory.cn
Our company is a professional company which is engaged in designing, manufacturing and selling woodworking machines. Since our establishment in 2009, we have got rapid development and a good... Basahin Higit pang mga »
  • Katad na produksyon makinarya | Tibag - mga tool machine | Packaging makinarya | Woodworking kagamitan
  • Qingdao
  • China
supplyautonomy.com/problend.bg
We offer : -constructing, manufacture, service and innovative production solutions for packaging equipment -constructing, manufacture, service and innovation of non-standard equipment on... Basahin Higit pang mga »
  • Pangkalahatang mekanikal mga bahagi stock | Packing at packaging - makinarya at kagamitan
  • Shumen
  • Bulgaria
supplyautonomy.com/hondonpackagingfoodmachinerygroup.cn
Paying attention to details, professional service, distinguished quality products and going the extra mile for our customers are the hallmark of Hondon. Supported by own manufacturing plants and... Basahin Higit pang mga »
  • Packing at packaging - makinarya at kagamitan | Packaging makinarya
  • Tianjin
  • China
supplyautonomy.com/sarongspa.it
SARONG is a private company situated in Reggiolo (RE), in the north of Italy. Founded in 1972 when it brought onto the market the first automatic packaging machine for pharmaceutical suppositories... Basahin Higit pang mga »
  • Packing at packaging - makinarya at kagamitan | Packaging makinarya
  • Reggiolo
  • Italya
supplyautonomy.com/dolzanimpiantisrl.it
Vertical packing machines, by weight / volume, with 4 welds, Doypack, vacuum, multi-track and semi-automatic for the food processing, pastry making, chemicals, pharmaceuticals and mechanical sectors.
  • Packing at packaging - makinarya at kagamitan | Pagkain industriya - makinarya at kagamitan
  • Galliera Veneta
  • Italya
supplyautonomy.com/kansanmachineryco.tr
Kansan Machinery Company -today one of the major wet wipes, tissue napkins, toilet papers/towels machines and complete converting lines manufacturers- was established in 1992 as a small workshop. In... Basahin Higit pang mga »
  • Pag-cap at overcapping capsules, plastic | Packaging makinarya | Kalinisan at palikuran ng mga produkto
  • İzmir
  • Turkey
supplyautonomy.com/sicogaz.fr
  • Exhibition nakatayo (hire / rental) | Exhibition halls (hire / rental) | Conference room (hire / rental) | Trade fair...
  • Puteaux
  • France