Loading...
தேடல் முடிவுகள்: பேக்கேஜிங் இயந்திரங்கள்
காணப்படும் 4346 நிறுவனங்கள்
supplyautonomy.com/trustarpharmapackingequipment.cn
Wenzhou Trustar Machinery Technology co.,ltd.is located in Ruian, Wenzhou, the capital of packaging and printing. The factory covers an area of about 7000 square meters and the office building area... மேலும் வாசிக்க »
- பேக்கேஜிங் இயந்திரங்கள்
- Wenzhou
- சீனா
supplyautonomy.com/tangshankingvidaprintingmachineryco.cn
The outstanding Tangshan Kingvida Printing Machinery Co., Ltd. is a professional manufacturer of printing and packaging machinery. Located in the central area of Beijing,Tianjin and Tangshan.The... மேலும் வாசிக்க »
- காகித வெட்டு - இயந்திரங்கள் மற்றும் உபகரணங்கள் | பேக்கேஜிங் இயந்திரங்கள் | அட்டைப்பெட்டி இயந்திரங்கள் மடிப்பு மற்றும் gl...
- Yutian County
- சீனா
supplyautonomy.com/zhejiangruianyongtaipackingmachinerymanufactureco.cn
Zhejiang Ruian Yongtai Packing Machinery Manufacture Co., Ltd is specialized in producing complete sets of flexible packaging equipment and has a long history. We specially produce various plastic... மேலும் வாசிக்க »
- பை இயந்திரங்கள் செய்யும் | பை இயந்திரங்கள் பாகங்கள் தயாரித்தல் | அச்சு இயந்திரங்கள் | நெளி அட்டை தொகுப்பு இயந்திரங்களை ...
- Wenzhou
- சீனா
supplyautonomy.com/guangdongqishengmachineryco.cn
supplyautonomy.com/lindumpackaging1.gb
We analyse what constraints are preventing our customers from achieving optimum efficiency. We know that they need the right products, in the right place, at the right time.
Production Can’t Stop ... மேலும் வாசிக்க »
- பேக்கேஜிங் ஆராய்ச்சி நிபுணர்கள் | தொகுப்புகள் மற்றும் பேக்கேஜிங் பொருட்கள் சோதனை | பேக்கேஜிங் சேவைகள் | வழக்குகள் மற்...
- Stallingborough, North East Lincolnshire
- பிரிடிஷ் கூட்டரசு
supplyautonomy.com/soonkpackagingmachine.cn
Foshan Soonk Packaging Machine Co., Ltd. is a professional advanced enterprise engaged in packaging machine research and development, design, production, sales and maintenance.
- பேக்கேஜிங் இயந்திரங்கள் மற்றும் உபகரணங்கள், இரண்டாவது கை | அடைத்தல் மற்றும் போர்த்தி - இயந்திரங்கள் மற்றும் உபகரணங்கள் ...
- Foshan
- சீனா
supplyautonomy.com/tubitexspa.it
supplyautonomy.com/antoniodominicifratellicostruzionimeccanichesrl.it
Production of machinery for the baking and food industries. Robotized systems for handling, chocolate egg wrappers, chocolate coin wrappers, nougat cookers and cutters, bakery machinery, automatic... மேலும் வாசிக்க »
- ரொட்டி மற்றும் பேஸ்ட்ரி தயாரித்தல் இயந்திரங்கள் பதப்படுத்தல் | மிட்டாய், இயந்திரங்கள் மற்றும் உபகரணங்கள் பதப்படுத்தல் ம...
- Perugia
- இத்தாலி
supplyautonomy.com/bidllc.ua
BID company - Pasta and packaging equipment manufacture
Dear Sirs!
The distinctive mark of our company is a wide range of pasta, drying and packaging equipment, which allows to produce pasta... மேலும் வாசிக்க »
- ரொட்டி மற்றும் பேஸ்ட்ரி தயாரித்தல் இயந்திரங்கள் பதப்படுத்தல் | உணவு துறை ஆலை மற்றும் உபகரணங்கள் NES | இயந்திரங்கள் பங்க...
- Dnepropetrovsk
- உக்ரைன்
supplyautonomy.com/rakshapackaging.in
The company formed in the year 1976 as a-class ancillary suppliers diversified into the field of packaging by the name of Raksha Packaging in the year 1994.
The growth in packaging industry is far... மேலும் வாசிக்க »
- பீஸ்ஸா பிரசவத்திற்கு கேரியர்கள், பிளாஸ்டிக், | உணவுப்பொருளை படம், பிளாஸ்டிக், | உணவுப்பொருளை ஐந்து பைகள், பிளாஸ்டிக், ...
- Faridabad
- இந்தியா
supplyautonomy.com/riddhipharmamachinery.in
Manufacturers and Exporters of Pharmaceutical Machineries. Our multitude of products include Pharmaceutical Machinery, Tablet Press Machine, Rotary Tablet Press Machine, Fluid Bed Dryer, Tray drier,... மேலும் வாசிக்க »
- உணவு துறை ஆலை மற்றும் உபகரணங்கள் NES | Extruders, மருந்து மற்றும் ஒப்பனை தொழில்கள் | எண்ணெய் சுத்திகரிப்பு ஆலை, மருந்து...
- Mumbai
- இந்தியா
supplyautonomy.com/acmemachineryindiapvt.in
Acme Machinery (India) Pvt. Ltd. is a professionally managed organization accredited for manufacturing and exporting of Paper Board Printing, Packaging and Converting Machineries since... மேலும் வாசிக்க »
- அட்டை செய்யும் இயந்திரங்கள், தொடர், உருளை | Moulds, உருளை, அட்டை தயாரித்தல் | மினுக்கூட்டுதல் இயந்திரங்கள், அட்டை மற்று...
- Mumbai
- இந்தியா
supplyautonomy.com/gdspa.it
G.D is the world's leading cigarette production and packaging machinery constructor. Its vast array of solutions makes G.D. the only company in a position to offer complete high-speed lines.
- Moisturisers, காலணி உற்பத்தி | வெட்டு புகையிலை மீதான குளிர்த்துபொறித்தொகுதி | கண்டன்சர்கள், சாப்பிடக்கூடாத எண்ணெய் மற்...
- Bologna
- இத்தாலி
supplyautonomy.com/reconmachinetoolspvt.in
Recon is a leading manufacturer of Plant and Machinery for Metal Cans, Metal Closures Steel Drums, also complete packaging lines for powder, liquid paste in metal containers.
Established in the... மேலும் வாசிக்க »
- கலப்பு இயந்திரங்கள் செய்யும் | பரிமாறுவதற்கு அமைப்புகள், முடியும் மூடி முடியும் | மற்றும் பீப்பாய் சுத்தம் மற்றும் சலவை ...
- Mumbai
- இந்தியா
supplyautonomy.com/assopackmachines.in
We have created a niche among quality-oriented corrugators. Our name inspires confidence not only among Indian corrugators but it is known for its reliability of its products in foreign markets... மேலும் வாசிக்க »
- , தள்ளாடி முறுக்கு மற்றும் காண்பதற்கான இயந்திரங்கள், papermaking | முறுக்கு, காண்பதற்கான மற்றும் குறைப்பு இயந்திரங்கள், ...
- Ahmedabad
- இந்தியா
supplyautonomy.com/gangasinghengineeringpvt.in
ESSGEE Exports is a proprietary concern established in 1993 and are very strong in exporting machinery which are mainly used in tin container industry, packaging industries and having vast knowledge... மேலும் வாசிக்க »
- அடுக்கு மாடி 'கருவிகள் | உணவு துறை ஆலை மற்றும் உபகரணங்கள் NES | நன்கு தோண்டும் எந்திரங்கள் | மற்ற ஜவுளி இயந்திரங்கள் | ...
- Mumbai
- இந்தியா
supplyautonomy.com/apsaraengineers.in
We the manufacturers and exporters of all kinds of textile related machinery, we are specialist in polyfill opening machinery, pillow packing machinery and blowfill machines in nominal cost.
We... மேலும் வாசிக்க »
- ஜவுளி இயந்திரங்கள் ஐந்து Spools, bobbins, கூம்புகள், பிளாஸ்டிக், | நூற்பு குழாய்கள், பிளாஸ்டிக் | நூற்பு இயந்திரங்கள் அட...
- Coimbatore
- இந்தியா
supplyautonomy.com/foshancitycoretamppackingmachineryco.cn
Foshan Coretamp Packaging Machinery Co.,Ltd. is located in China Machinery Center - Foshan city, takes 30 minutes to Guangzhou and 2 hours to Shenzhen/Hong Kong. We are a leading manufacturer of all k... மேலும் வாசிக்க »
- பேக்கேஜிங் இயந்திரங்கள்
- Foshan
- சீனா
supplyautonomy.com/excellpacks.in
Welcome
Empowering people through prosperity and helping them create wealth have been the mission of VK Engineering & Company since 2000
VK Engineering & Company and heir... மேலும் வாசிக்க »
- பேக்கிங் மற்றும் பேக்கேஜிங் - இயந்திரங்கள் மற்றும் உபகரணங்கள் | பேக்கேஜிங் இயந்திரங்கள் மற்றும் உபகரணங்கள் | பேக்கேஜிங் ...
- Coimbatore, Tamil Nādu
- இந்தியா
supplyautonomy.com/cooltechenterprises.in
A renowned name in the domain of Cooling Pads, ABS Ductable Cooling Machine, Desert/Room Coolers, etc., Cool Tech Enterprises has been offering quality to the clients. Combining technology and wide... மேலும் வாசிக்க »
- பாதுகாப்பு தயாரிப்பு முகவர் | பரிமாற்ற அச்சிடும் | ஊசி மருந்து வடிவமைத்தல் சேவைகள், உலோக | காப்பு பொருட்கள் | விருப்ப ...
- Amravati
- இந்தியா
supplyautonomy.com/chamundaindustries.in
We are pleased to introduce ourselves as one of the leading Exporters, Manufacturers , Stockists Supplier of stainless steel item,ferrous non-ferrous metal which are required by your company in... மேலும் வாசிக்க »
- பாதுகாப்பு தயாரிப்பு முகவர் | பரிமாற்ற அச்சிடும் | ஊசி மருந்து வடிவமைத்தல் சேவைகள், உலோக | காப்பு பொருட்கள் | விருப்ப ...
- Mumbai
- இந்தியா
supplyautonomy.com/preciousmineralprocessingsystemspvt.in
CHITRA PHARMA MACHINERY
PRECIOUS FAB-CAST PVT. LTD. , the parent company of CHITRA PHARMA MACHINERY-an ISO 9001: 2000 company is the designer, developer, manufacturer and exporter of various... மேலும் வாசிக்க »
- உபகரணங்கள் சுத்தம் | உணவு துறை ஆலை மற்றும் உபகரணங்கள் NES | நன்கு தோண்டும் எந்திரங்கள் | அரைக்கும் உலோக இயந்திர கருவிக...
- Ahmedabad
- இந்தியா
supplyautonomy.com/kusodalamuthucopvt.in
Bharath Paper Conversions are manufacturers and exporters of high quality Paper Cones, Paper Tubes, Paper Cores, Edge Protectors, Composite Cans and Pulp Moulded Products. Established in 1984, the... மேலும் வாசிக்க »
- தட்டுக்களில், fibreboard | குழாய்கள், காகிதம் அல்லது fibreboard | குழாய்கள், காகிதம் அல்லது fibreboard, காயம் | குழாய்கள...
- Coimbatore
- இந்தியா
supplyautonomy.com/seniorprintpackmachineryco.in
Manufacturers & Exporters Of Corrugated Board, Box Making Machinery, Corrugated Board Making Plant, Die Punching, Cutting, Creasing & Embossing Machine, Hot Foil Stamping Die Cutting... மேலும் வாசிக்க »
- பை இயந்திரங்கள் செய்யும் | அச்சிடுதல் மற்றும் கிராபிக்ஸ் உபகரணங்கள் | காகித வரிசையாக்க இயந்திரங்கள் மற்றும் உபகரணங்கள் |...
- Hyderabad
- இந்தியா
supplyautonomy.com/finopack.cn
An open mouth bagging machine is an automatic filling and sealing machine which fills products into bags up to a specific weight, and closes the bag mouth automatically. Our automatic bagging and... மேலும் வாசிக்க »
- பேக்கேஜிங் இயந்திரங்கள் மற்றும் உபகரணங்கள் | பேக்கேஜிங் இயந்திரங்கள் | சிப்பமிடுதல் இயந்திர பாகங்கள்...
- Hefei
- சீனா