Loading...
Search Results for: Recovery and regeneration of volatile organic compounds (VOC)
Found 37 companiesPreferred listings related to: Recovery and regeneration of volatile organic compounds (VOC)
supplyautonomy.com/leeaimportexport.tr
We are traders of carbon and graphite components for submersible motors. We trade carbon bearings, carbon thrust bearings and complete thrust sets (carbon thrust bearing, metal base, and segmented... Read More »
- Regeneration of catalysts | Regeneration services for activated carbon | Recovery and regeneration of photographic...
- İstanbul
- Turkey
supplyautonomy.com/tbfenvironmentaltechnology1.ca
TBF Environmental Technology manufactures innovative solvents which reduce the atmospheric emission of VOCs, HAPs and GHGs. TBF\'s non-toxic solvents reduce the health risk to ten million US... Read More »
- Recovery and regeneration of volatile organic compounds (VOC) | Environmental technology research
- Surrey
- Canada
supplyautonomy.com/haldortopsoeeinternationalas.dk
Profil Haldor Topsøe's technologies and catalysts are used around the world creating a better environment - in the refining industry ensuring cleaner fuels, for cleaning power industry flue ... Read More »
- Regeneration of catalysts | Regeneration services for activated carbon | Recovery and regeneration of photographic...
- Lyngby
- Denmark
supplyautonomy.com/cometamsa.fr
supplyautonomy.com/johnsonmattheyfuelcellslimited.gb
Export Johnson Matthey is a speciality chemicals company focussed on its core skills in precious metals, catalysts and fine chemicals. It is organised into three global divisions: Environmental... Read More »
- Regeneration of catalysts | Regeneration services for activated carbon | Recovery and regeneration of photographic...
- London
- United Kingdom
supplyautonomy.com/uspnettoyage.fr
- Leakage detection and location services, pipelines | Clean rooms, turnkey projects | Biofuel plant, turnkey projects |...
- Arcueil
- France
supplyautonomy.com/johnsonmattheybrandenbergerag.ch
- Jewellery and bijouterie | Regeneration of catalysts | Regeneration services for activated carbon | Recovery and...
- Zürich
- Switzerland
supplyautonomy.com/greencrosshealthinnovation.in
Green Cross Health Innovation with an objective to provide healthcare solutions, without side effects, launches its brand VitaGreen. The company produces an extensive range of Ayurveda/Herbal... Read More »
- Recovery and regeneration of volatile organic compounds (VOC) | Pharmaceutical articles | Gastrointestinal healthcare...
- Mumbai
- India
supplyautonomy.com/basfautomotivecoatingsservices.fr
- Engineering - industrial contractors | Equipped offices and industrial premises - services | Children's homes |...
- Breuil
- France
supplyautonomy.com/mahavirrefractoriescorporation.in
Manufacturer and Exporters of Stockists of all Types of Refractories High Alumina, Silliminate, Insulation, Acid Proof Brick Castable, Fire Cements and Fire Clay of all Grades Ceramic, Blankets,... Read More »
- Regeneration of catalysts | Regeneration services for activated carbon | Recovery and regeneration of photographic...
- Mumbai
- India
supplyautonomy.com/islandwidemarketingservicespvt.lk
Import & Supply of Industrial Chemicals,Machinery Lab Equipment,Packaging along with the Technological Inputs & Clearing & Forwarding Agents,Export of Coconut based... Read More »
- Recovery and regeneration of volatile organic compounds (VOC) | Protein purification services | Sieving of liquids for...
- Rajagiriya
- Sri Lanka
supplyautonomy.com/developpementbernardplasencia.fr
- Pharmaceutical production engineering consultants | Biochemical engineering consultants | Regeneration services for...
- Saint-Priest
- France
supplyautonomy.com/lgobbisrl.it
- Production services, dietary supplements | Regeneration of catalysts | Regeneration services for activated carbon |...
- CAMPO LIGURE (GE)
- Italy
supplyautonomy.com/norskmiljogresirkuleringas.no
- Regeneration of catalysts | Regeneration services for activated carbon | Recovery and regeneration of photographic...
- Oslo
- Norway
supplyautonomy.com/corquimiaindustrialsl.es
- Production services, dietary supplements | Importers-exporters, chemicals | Regeneration of catalysts | Regeneration...
- Esplugues de Llobregat
- Spain
supplyautonomy.com/hansanderssonplasticsab.se
- Internal combustion engine engineering consultants | Inorganic chemistry and chemical technology engineering...
- Staffanstorp
- Sweden
supplyautonomy.com/isovatoras.no
- Regeneration of catalysts | Regeneration services for activated carbon | Recovery and regeneration of photographic...
- Hokksund
- Norway
supplyautonomy.com/safinaas.cz
- Refractory installation services | Regeneration of catalysts | Regeneration services for activated carbon | Recovery...
- Jesenice
- Czech Republic
supplyautonomy.com/chinaindustrialmaterials.gb
- Chemicals - import-export | Regeneration of catalysts | Regeneration services for activated carbon | Recovery and...
- West Bromwich
- United Kingdom
supplyautonomy.com/thermexcarbontechpty.za
Manufacturers of reactivation furnaces and filters forthe gold extraction, water purification applications (including Municipalites), sugar mill and gas filtration industries.
- Regeneration of catalysts | Regeneration services for activated carbon | Recovery and regeneration of photographic...
- Johannesburg
- South Africa
supplyautonomy.com/astrhul.fr
- Regeneration of catalysts | Regeneration services for activated carbon | Recovery and regeneration of photographic...
- LIRE
- France
supplyautonomy.com/frankeedelmetaalbv.nl
- Regeneration of catalysts | Regeneration services for activated carbon | Recovery and regeneration of photographic...
- Maarssen
- Netherlands
supplyautonomy.com/elbarkatowicespzoooddziacarbonwraciborzu.pl
- Regeneration of catalysts | Regeneration services for activated carbon | Recovery and regeneration of photographic...
- Racibórz
- Poland
supplyautonomy.com/hydrabat.fr
- Industrial equipment hire | Recycling plant engineering consultants | Regeneration services for activated carbon |...
- St Michel Sur Orge
- France
supplyautonomy.com/servithen.fr
- Engineering - industrial contractors | Equipped offices and industrial premises - services | Recovery and regeneration...
- Neauphle-le-Château
- France
supplyautonomy.com/rheinischetonwerkehsiemesek.de
- Import-export - agents | Regeneration services for activated carbon | Recovery and regeneration of volatile organic...
- Brüggen
- Germany
supplyautonomy.com/richardgeigmbh.de
- Recovery and regeneration of volatile organic compounds (VOC) | Inks | Paints and varnishes | Ink, printing
- Offingen
- Germany
supplyautonomy.com/aprochim.fr
- Regeneration services for activated carbon | Recovery and regeneration of volatile organic compounds (VOC) |...
- Grez-sur-Loing
- France
supplyautonomy.com/wieseloadingtechnologybv.nl
- Recovery and regeneration of volatile organic compounds (VOC) | Petrochemical industry - installations and equipment
- Bergambacht
- Netherlands
supplyautonomy.com/ribatextiles.in
Manufacturer & Exporter of Towels.
- Recovery of natural and synthetic resins | Recovery and regeneration of volatile organic compounds (VOC) | Distillation...
- New Delhi
- India