Search Results for: Subcontractors for the chemical industry

Found 207 companies


supplyautonomy.com/carif.fr
Manufacturer of flour correctors, ingredients and improvers for baking, pastry-making, sweet pastries and biscuit making, breadmaking enzymes, mixes and premixes for special breads, mixes for... Read More »
  • Sieving of solids for the chemical industry | Classification services, fine chemicals | Granulating services for...
  • L’Union
  • France
supplyautonomy.com/dilers.lv
Company Dilers SIA is the Latvian manufacturer of aluminium alloys: - casting alloys in ingots DIN 226, DIN 231, DIN 230, DIN 260 etc - extrusion billets 60XX series, 178 mm, homogenised -... Read More »
  • Blending of paints and pigments for the chemical industry | Marking machines for roads, car parks and floors |...
  • Riga
  • Latvia
supplyautonomy.com/librawpharma.in
Manufacturers and Exporters Of Pharmaceutical Products Like Tablets Including Polyoxyl 40 Hydrogenated Castor Oil, Solvent Enteric Coating Polymer, Lake Colours Aqueous Enteric Coating Polymers,... Read More »
  • Blending of pharmaceuticals | Spray drying of pharmaceuticals | Protein purification services | Extraction and...
  • New Delhi
  • India
supplyautonomy.com/aimetalsp.in
100% Export Oriented Unit. Manufacturing Pure Lead Ingots, Antimony Lead Alloy Processing all type of ferrous and non ferrous metal scrap Importer of Ferrous and Non ferrous metal scrap
  • Solvent recovery engineering consultants | Distillation of chemicals | Cleaning products, chemical, for electric and...
  • New Delhi
  • India
supplyautonomy.com/skchemicals.in
Allow us to introduce ourselves as one of the leading companies in the field of washing and cleaning chemicals industry. We are in the field for over one decades and have, therefore, got vast... Read More »
  • Distillation of chemicals | Additives for oil well drilling mud/fluids | Defoamers, mining and oil extraction |...
  • New Delhi
  • India
supplyautonomy.com/hrsprocesssystems.in
Manufacturers, Exporters & Importers Of Wide Range Of Heat Exchangers, ECOFLUX* Corrugated Tube Heat Exchanger, Shell And Tube Heat Exchanger, UNICUS® Scraped Surface Heat Exchanger, ... Read More »
  • Production services, dietary supplements | Blending of pharmaceuticals | Spray drying of pharmaceuticals | Protein...
  • Pune
  • India
supplyautonomy.com/societepercageusinageducarembault.fr
  • Processing services for dairy products | Processing services, industrial oils | Bone processing machinery, glue and...
  • Phalempin
  • France
supplyautonomy.com/anhydrouk.gb
Drying and cooling equipment machinery manufacturers including spray - flash - ring - and fluid bed. Spray chilling plant manufacturers. Suppliers of plant microencapulation. Full test facilities are... Read More »
  • Industrial facilities - design | Powder technology consultants | Spray drying services for the food industry | Spray...
  • Tonbridge
  • United Kingdom
supplyautonomy.com/sofresidengineering.fr
  • Pipework contractors, chemical and nuclear effluent systems | Pipework installation contractors, chemical plant |...
  • Montigny-le-Bretonneux
  • France
supplyautonomy.com/sweco.us
  • Sieving of solids for the chemical industry | Humidifiers, meal, edible vegetable oil processing | Heaters, edible...
  • Florence
  • United States
supplyautonomy.com/johnsonmattheyfuelcellslimited.gb
Export Johnson Matthey is a speciality chemicals company focussed on its core skills in precious metals, catalysts and fine chemicals. It is organised into three global divisions: Environmental... Read More »
  • Regeneration of catalysts | Regeneration services for activated carbon | Recovery and regeneration of photographic...
  • London
  • United Kingdom
supplyautonomy.com/robinsonwirecloth.gb
Robinson Wire Cloth Ltd are a supplier of all types of filter meshes and materials. Our extensive in-house facilities enable us to manufacture woven mesh screens, tension screens and bonded screens... Read More »
  • Sieving of liquids for the chemical industry | Sieving of solids for the chemical industry | Sieving of pastes for the...
  • Stoke On Trent
  • United Kingdom
supplyautonomy.com/univar.fr
  • Chemicals - import-export | Protein purification services | Sieving of pastes for the chemical industry | Air...
  • Fontenay-sous-Bois
  • France
supplyautonomy.com/upgreensas.fr
  • Manufacture of soap and detergents, cleaning and polishing preparations | Mixing and blending of liquids for the...
  • Strasbourg
  • France
supplyautonomy.com/worldwaybiotech.cn
World-Way is specialized in marketing plant-derived extracts and fine chemicals for the nutraceutical, food and cosmetic industries for 15 years. World-Way is founded by Dr. Ginkgo Zeng, Professor in... Read More »
  • Classification services, fine chemicals | Fine chemicals | Other fine chemicals | Extracts
  • Changsha
  • China
supplyautonomy.com/islandwidemarketingservicespvt.lk
Import & Supply of Industrial Chemicals,Machinery Lab Equipment,Packaging along with the Technological Inputs & Clearing & Forwarding Agents,Export of Coconut based... Read More »
  • Recovery and regeneration of volatile organic compounds (VOC) | Protein purification services | Sieving of liquids for...
  • Rajagiriya
  • Sri Lanka
supplyautonomy.com/todecasa.es
  • Classification services, fine chemicals | Distillation of chemicals | Yeast for the beverage industry | Yeast, bakers'...
  • Barcelona
  • Spain
supplyautonomy.com/sudarshandhoopp.in
Manufacturers and Exporters of Incense Products like Dhoop, Agarbathi Coils and Cones, Extruded Bambooless Sticks, Incense Sticks, Magical Charcoal Tablets, Pure Natural Agarbatti, Incense Gift Sets... Read More »
  • Production services, dietary supplements | Filling and packaging services, solvents and adhesives, industrial |...
  • New Delhi
  • India
supplyautonomy.com/stridesarcolab.in
Manufacturer, Exporters and Importers of Antibiotics, Cephalophins, Nutracentieah, HIV Rearoviral, Vitamins, Soft Gelatin Capsule, Tablet, Liquid Injection, Dry Powder Injection, Oral Solid Dosage... Read More »
  • Production services, dietary supplements | Blending of pharmaceuticals | Spray drying of pharmaceuticals | Protein...
  • Bengaluru
  • India
supplyautonomy.com/hosokawamicronlimited.gb
Hosokawa Micron Ltd is your single source for integrated powder processing systems and containment solutions. Our core products and services include particle design for nano technology, size... Read More »
  • Mixing and blending technology engineering consultants | Production services, dietary supplements | Blending of...
  • Runcorn
  • United Kingdom
supplyautonomy.com/developpementbernardplasencia.fr
  • Pharmaceutical production engineering consultants | Biochemical engineering consultants | Regeneration services for...
  • Saint-Priest
  • France
supplyautonomy.com/aircontrolsa.es
  • Cooling plant, turnkey projects | Production services, dietary supplements | Blending of pharmaceuticals | Spray drying...
  • San Sebastián
  • Spain
supplyautonomy.com/borgessa.es
  • Grouting, plaster based | Production services, dietary supplements | Commodity merchants, raw rubber and latex |...
  • Reus
  • Spain
supplyautonomy.com/crealis.fr
  • Management advice | Distillation of chemicals | Cleaning products, chemical, for electric and electronic installations...
  • Bry
  • France
supplyautonomy.com/novissrl.it
  • Synthesising services, chemical | Chromating chemicals for metals | Chromium plating chemicals | Additives, chemical,...
  • Calenzano
  • Italy
supplyautonomy.com/azelisfrance.fr
  • Production services, dietary supplements | Chemicals - import-export | Blending of pharmaceuticals | Spray drying of...
  • Paris
  • France
supplyautonomy.com/epiingredients.fr
  • Blending of pharmaceuticals | Blending of paints and pigments for the chemical industry | Ginger oil | Powdered and...
  • Ancenis
  • France
supplyautonomy.com/ktronfrance.fr
  • Production services, dietary supplements | Filling and packaging services, solvents and adhesives, industrial |...
  • Croissy-sur-Celle
  • France