Loading...
Search Results for: Paketimi makina
Kompanitë e gjetura 7631Related Categories
supplyautonomy.com/pentagonmarketing.in
Available in various dimensions, specifications, capacities, efficiency, etc, packaging machinery find applications in various industries like chemical, marine, food, etc. Pentagon Marketing is... Lexo më shumë »
- Printera, fotografia | Markera | Ngjitëse dhe kasetë | Paketimi makineri
- Kochi
- Indi
supplyautonomy.com/taisunmachinery.tw
Tai sun machinery Co., ltd has been concentrating on the manufacture of the tissue paper converting machine since 1970. Now the "tai sun" brand has successfully exported
A big quantity of... Lexo më shumë »
- Peshqir marrjes makineri | Paketimi makineri
- Taipei
- Tajvan
supplyautonomy.com/iterrainintlenterprisesco.tw
In the manufacture of those machines we use the most advanced modern techniques. We take pride in having offered the overseas markets products of unsurpassed quality and appearance for the 27 years.... Lexo më shumë »
- Fasule kafeje, JAVA | Makineri të tjera të përdorura | Paketimi makineri
- Taichung
- Tajvan
supplyautonomy.com/masaelimachinemanufacturing.ir
Masaeli Industry Machinery is a leading company is Iran`s packing industry founded in 1983.Our main products include pillow packing machines that are suitable for packing all of things in different... Lexo më shumë »
- Paketimi makineri | Paketimi linjë
- Esfahan
supplyautonomy.com/ptsancoindonesia.id
Sanco international based in Jakarta, Indonesia is a marketing arms company that owns an exclusive right to promote and to distribute end products from manufacturer of confectionery products in... Lexo më shumë »
- Kapsulë mbushje makinë | Paketimi makineri
- Jakarta
- Indonezi
supplyautonomy.com/baodingjialifoodmachine.cn
Established in 1998, Baoding Jiali Food Machine Co.,ltd is a professional manufacturer engaged in research, development, production, sale and service of all kinds of food machines. Excellent... Lexo më shumë »
- Industria ushqimore bimore dhe nes pajisjet | Paketimi makineri
- Baoding
- Kinë
supplyautonomy.com/zhejiangruianyongxinmachineryfactory.cn
Ruian Yongxin Machinery Factory is located in Ruian, Zhejiang province, the famous City of Packaging Machinery in China. It always devotes itself to researching and developing packaging or... Lexo më shumë »
- Makineri të tjera farmaceutike | Paketimi makineri
- Ruian
- Kinë
supplyautonomy.com/zhangjiagangkingstepmachineryco.cn
Our quality products are:
Pure/Mineral water production lines
Carbonated drink production lines;
Fruit juice production lines
Tea drink production lines
Soy milk and protein drink production... Lexo më shumë »
- Ujë të pastër | Paketimi makineri
- Suzhou
- Kinë
supplyautonomy.com/nissionfoodmachinerycorporation.cn
Qingdao Nissin Food Machinery Co., Ltd. is a Sino-Japanese joint venture established in 1989. Our company applies complete Japanese technology, blueprints and components and works together with... Lexo më shumë »
- Makineri rostiçeri | Paketimi makineri
- Qingdao
- Kinë
supplyautonomy.com/hbfpt.cn
Our company originates at the beginning of the 1990. Our predecessor is the Shijjiazhuang Changan Stainless Steel Plant, with the registered capital of 1,800,000 and a staff of 70 people.
Our... Lexo më shumë »
- Industria ushqimore bimore dhe nes pajisjet | Heqin tabelat | Paketimi makineri | Staples, teli
- Shijiazhuang
- Kinë
supplyautonomy.com/guangzhouhaochiwoodworkingmachineryco.cn
Guangzhou JianChi Woodworking Machinery Co., Ltd. locates in ShaWan Town, Panyu Area, Guangzhou City. We have been insisting on the aim of "survive with quality and develop with... Lexo më shumë »
- Paketimi makineri | Pajisje Njoftime
- Guangzhou
- Kinë
supplyautonomy.com/greatelectricsmachineco.cn
Since our establishment in 1989, Great-Electrics Machine Co., Ltd. has been the leading manufacturer in the thermoforming machine industry in China. We have a strong research and development team to... Lexo më shumë »
- Saldim Pajisjet | Welders plastike | Paketimi makineri | Tabaka Veza
- Guangzhou
- Kinë
supplyautonomy.com/jayengineeringcombine.in
Standard spares and machineries for soap, detergent, chemicals HVAC Plants
JAY ENGINEERING... Lexo më shumë »
- Paketimi makineri
- Ahmedabad
- Indi
supplyautonomy.com/bossengineeringcompany.in
Backed by industry experience of about a decade, we are engaged in manufacturing a completely automatic range of machines used in filling, capping, and labeling of bottles and containers. Our range... Lexo më shumë »
- Paketimi makineri | Makine farmaceutike paketimit | Materiale të tjera Packaging
- Ahmedabad
- Indi
supplyautonomy.com/shreejipharmatech.in
About Us
Shreeji Pharmatech is one of the pioneering manufacturers of a wide range of Pharmaceutical Machineries like Dry Injectable Powder Filling Machine, Semi-automatic Dry Injectable Powder... Lexo më shumë »
- Makineri të tjera tekstile | Paketimi makineri
- Ahmedabad
- Indi
supplyautonomy.com/masterfil.gb
The Adelphi Group of Companies has served customers all over the world for over 60 years. Our products range form simple stainless steel vessels to complete turnkey filling and capping lines, all... Lexo më shumë »
- Paketimi dhe paketimi - Makineri dhe pajisje | Drums, kovat dhe fuçi
- Aylesbury
- Mbretëria e Bashkuar
supplyautonomy.com/susmatexmachinery.in
Dear Visitors and customers,
First of all, we would like to tell thanks to visitors and customers who visiting our website, so we are greatly pleased to introduce our company and our products to... Lexo më shumë »
- Makinat Lace | Paketimi makineri
- Ahmedabad
- Indi
supplyautonomy.com/omchamundaenterprises.in
A om chamunda enterprisesis one of the leading manufacturer, exporter and supplier of packaging machine from India. Designed for efficient operation to meet the varying requirements of different... Lexo më shumë »
- Kapsulë mbushje makinë | Paketimi makineri
- Mumbai
- Indi
supplyautonomy.com/shrivinayakpackagingmachinepvt.in
Incorporated in the year 2000, Shri Vinayak Print-Pack is a leading importer and supplier of packaging machines. The range includes semi / fully automatic packaging machines, strapping machines,... Lexo më shumë »
- Paketimi makineri | Leukoplast
- New Delhi
- Indi
supplyautonomy.com/labhprojectspvt.in
Welcome to Labh Group!
Labh Group of Companies is a fast growing, well- recognized and an ISO 9001:2008 certified, Indian business group of global repute having presence in more than 100 countries... Lexo më shumë »
- Qese oriz | Paketimi makineri | Leukoplast
- Ahmedabad
- Indi
supplyautonomy.com/rubyenterprise.in
Jaw crusher, complete crushing plant screening plant
- Well-shpimit makineri | Makineri të përdorura minierave | Paketimi makineri
- Hooghly
- Indi
supplyautonomy.com/brintexsalescorporation.in
Unicon Exports and Imports, is an acknowledged manufacturer and supplier of Pharmaceutical machines for different pharmaceutical sections viz. Granulation section, Liquid Section, Ointment Section... Lexo më shumë »
- Glass Makineri të përpunimit | Kapsulë mbushje makinë | Paketimi makineri | Qelqe laborator dhe pajisje
- New Delhi
- Indi
supplyautonomy.com/relianceenterprise.in
Offering a wide range of Food Processing & Bakery Equipments such as Tomato Ketchup machine, Single Door Deck Oven, Planetary mixer, Spiral mixer, Rotary rack Oven, Tray Dryer, Vacuum Bottle... Lexo më shumë »
- Industria ushqimore bimore dhe nes pajisjet | Machine Mjetet për metal mulliri | Paketimi makineri | Qelqe laborator ...
- Kolkata
- Indi
supplyautonomy.com/qingdaothinrawoodworkingmachineryfactory.cn
Our company is a professional company which is engaged in designing, manufacturing and selling woodworking machines. Since our establishment in 2009, we have got rapid development and a good... Lexo më shumë »
- Prodhimi lëkure makineri | Prerje - machine tools | Paketimi makineri | Pajisje Njoftime
- Qingdao
- Kinë
supplyautonomy.com/problend.bg
We offer :
-constructing, manufacture, service and innovative production solutions for packaging equipment
-constructing, manufacture, service and innovation of non-standard equipment on... Lexo më shumë »
- Komponentet e përgjithshme mekanike Stock | Paketimi dhe paketimi - Makineri dhe pajisje
- Shumen
- Bullgari
supplyautonomy.com/hondonpackagingfoodmachinerygroup.cn
Paying attention to details, professional service, distinguished quality products and going the extra mile for our customers are the hallmark of Hondon. Supported by own manufacturing plants and... Lexo më shumë »
- Paketimi dhe paketimi - Makineri dhe pajisje | Paketimi makineri
- Tianjin
- Kinë
supplyautonomy.com/sarongspa.it
SARONG is a private company situated in Reggiolo (RE), in the north of Italy. Founded in 1972 when it brought onto the market the first automatic packaging machine for pharmaceutical suppositories... Lexo më shumë »
- Paketimi dhe paketimi - Makineri dhe pajisje | Paketimi makineri
- Reggiolo
- Itali
supplyautonomy.com/dolzanimpiantisrl.it
Vertical packing machines, by weight / volume, with 4 welds, Doypack, vacuum, multi-track and semi-automatic for the food processing, pastry making, chemicals, pharmaceuticals and mechanical sectors.
- Paketimi dhe paketimi - Makineri dhe pajisje | Industria e ushqimit - makineri dhe pajisje
- Galliera Veneta
- Itali
supplyautonomy.com/kansanmachineryco.tr
Kansan Machinery Company -today one of the major wet wipes, tissue napkins, toilet papers/towels machines and complete converting lines manufacturers- was established in 1992 as a small workshop. In... Lexo më shumë »
- Mbulimi dhe overcapping kapsula, plastike | Paketimi makineri | Higjena dhe produkte higjienike
- İzmir
- Turqi