Kết quả tìm kiếm cho: Máy móc bao bì

Công ty 4346 được tìm thấy


supplyautonomy.com/trustarpharmapackingequipment.cn
Wenzhou Trustar Machinery Technology co.,ltd.is located in Ruian, Wenzhou, the capital of packaging and printing. The factory covers an area of about 7000 square meters and the office building area... Đọc thêm »
  • Máy móc bao bì
  • Wenzhou
  • Trung Quốc
supplyautonomy.com/tangshankingvidaprintingmachineryco.cn
The outstanding Tangshan Kingvida Printing Machinery Co., Ltd. is a professional manufacturer of printing and packaging machinery. Located in the central area of Beijing,Tianjin and Tangshan.The... Đọc thêm »
  • Giấy cắt - máy móc thiết bị | Máy móc bao bì | Carton gấp và Máy dán máy
  • Yutian County
  • Trung Quốc
supplyautonomy.com/zhejiangruianyongtaipackingmachinerymanufactureco.cn
Zhejiang Ruian Yongtai Packing Machinery Manufacture Co., Ltd is specialized in producing complete sets of flexible packaging equipment and has a long history. We specially produce various plastic... Đọc thêm »
  • Làm túi Máy móc | Làm túi Phụ tùng máy | Máy in | Làm cho gói các tông sóng máy | Máy móc bao bì | Máy đóng gói | Máy mó...
  • Wenzhou
  • Trung Quốc
supplyautonomy.com/guangdongqishengmachineryco.cn
  • Co lại máy bao bì phim | Máy móc bao bì | Đa chức năng bao bì Máy móc | Máy bao bì | Bao bì và đóng gói máy móc thiết bị...
  • Foshan
  • Trung Quốc
supplyautonomy.com/lindumpackaging1.gb
We analyse what constraints are preventing our customers from achieving optimum efficiency. We know that they need the right products, in the right place, at the right time. Production Can’t Stop ... Đọc thêm »
  • Chuyên gia tư vấn nghiên cứu bao bì | Thử nghiệm các gói và vật liệu đóng gói | Dịch vụ đóng gói | Trường hợp và ngực - ...
  • Stallingborough, North East Lincolnshire
  • Vương quốc Anh
supplyautonomy.com/soonkpackagingmachine.cn
Foshan Soonk Packaging Machine Co., Ltd. is a professional advanced enterprise engaged in packaging machine research and development, design, production, sales and maintenance.
  • Bao bì máy móc, thiết bị, cũ | Niêm phong và đóng gói - máy móc thiết bị | Bao bì và đóng gói - máy móc thiết bị | Gói n...
  • Foshan
  • Trung Quốc
supplyautonomy.com/tubitexspa.it
Paperboard tubes and cores - Packaging articles and products - Paperboard cases and boxes for packaging
  • Khay, ván sợi ép | Ống, giấy hay ván sợi ép | Ống, giấy hay ván sợi ép, vết thương | Ống, ván sợi ép, lót | Ống, strawbo...
  • Zona Industriale
  • Ý
supplyautonomy.com/antoniodominicifratellicostruzionimeccanichesrl.it
Production of machinery for the baking and food industries. Robotized systems for handling, chocolate egg wrappers, chocolate coin wrappers, nougat cookers and cutters, bakery machinery, automatic... Đọc thêm »
  • Máy nhào bánh mì, bánh ngọt và làm | Nhào trộn và máy móc thiết bị, bánh kẹo | Chế tạo khuôn mẫu nhà máy và thiết bị, bá...
  • Perugia
  • Ý
supplyautonomy.com/bidllc.ua
BID company - Pasta and packaging equipment manufacture Dear Sirs! The distinctive mark of our company is a wide range of pasta, drying and packaging equipment, which allows to produce pasta... Đọc thêm »
  • Máy nhào bánh mì, bánh ngọt và làm | Cây công nghiệp thực phẩm và thiết bị nes | Máy móc cổ phiếu | Bao bì và đóng gói -...
  • Dnepropetrovsk
  • Ukraina
supplyautonomy.com/rakshapackaging.in
The company formed in the year 1976 as a-class ancillary suppliers diversified into the field of packaging by the name of Raksha Packaging in the year 1994. The growth in packaging industry is far... Đọc thêm »
  • Tàu sân bay, nhựa, việc giao hàng bánh pizza | Phim, nhựa, chế biến thực phẩm | Túi xách, nhựa, chế biến thực phẩm | Con...
  • Faridabad
  • Ấn Độ
supplyautonomy.com/riddhipharmamachinery.in
Manufacturers and Exporters of Pharmaceutical Machineries. Our multitude of products include Pharmaceutical Machinery, Tablet Press Machine, Rotary Tablet Press Machine, Fluid Bed Dryer, Tray drier,... Đọc thêm »
  • Cây công nghiệp thực phẩm và thiết bị nes | Máy đùn, các ngành công nghiệp dược phẩm và mỹ phẩm | Nhà máy chế biến dầu, ...
  • Mumbai
  • Ấn Độ
supplyautonomy.com/acmemachineryindiapvt.in
Acme Machinery (India) Pvt. Ltd. is a professionally managed organization accredited for manufacturing and exporting of Paper Board Printing, Packaging and Converting Machineries since... Đọc thêm »
  • Bìa cứng làm cho máy móc, liên tục, xi lanh | Khuôn mẫu, xi lanh, làm tông | Máy calendering, các tông và bìa làm | Máy ...
  • Mumbai
  • Ấn Độ
supplyautonomy.com/gdspa.it
G.D is the world's leading cigarette production and packaging machinery constructor. Its vast array of solutions makes G.D. the only company in a position to offer complete high-speed lines.
  • Dưỡng ẩm, sản xuất giày dép | Nhà máy làm mát cho thuốc lá cắt | Thiết bị ngưng tụ, dầu không ăn được và sản xuất chất b...
  • Bologna
  • Ý
supplyautonomy.com/reconmachinetoolspvt.in
Recon is a leading manufacturer of Plant and Machinery for Metal Cans, Metal Closures Steel Drums, also complete packaging lines for powder, liquid paste in metal containers. Established in the... Đọc thêm »
  • Tổng hợp có thể làm cho máy móc | Hệ thống vận chuyển, có thể và có thể nắp | Có thể và thùng làm sạch và rửa máy móc | ...
  • Mumbai
  • Ấn Độ
supplyautonomy.com/assopackmachines.in
We have created a niche among quality-oriented corrugators. Our name inspires confidence not only among Indian corrugators but it is known for its reliability of its products in foreign markets... Đọc thêm »
  • Quay cuồng, quanh co và máy tua, làm giấy | Quanh co, Máy quấn và cắt, nhiều hoạt động, làm giấy | Bàn cặp, an toàn và t...
  • Ahmedabad
  • Ấn Độ
supplyautonomy.com/gangasinghengineeringpvt.in
ESSGEE Exports is a proprietary concern established in 1993 and are very strong in exporting machinery which are mainly used in tin container industry, packaging industries and having vast knowledge... Đọc thêm »
  • Công cụ xây dựng ' | Cây công nghiệp thực phẩm và thiết bị nes | Máy móc thiết bị khoan giếng | Dệt may Máy móc khác | D...
  • Mumbai
  • Ấn Độ
supplyautonomy.com/apsaraengineers.in
We the manufacturers and exporters of all kinds of textile related machinery, we are specialist in polyfill opening machinery, pillow packing machinery and blowfill machines in nominal cost. We... Đọc thêm »
  • Cuộn, bobbins, nón, nhựa, máy móc dệt may | Ống quay, nhựa | Thẻ và bản vẽ lon, nhựa, dùng cho máy quay | Dây, nhựa, máy...
  • Coimbatore
  • Ấn Độ
supplyautonomy.com/foshancitycoretamppackingmachineryco.cn
Foshan Coretamp Packaging Machinery Co.,Ltd. is located in China Machinery Center - Foshan city, takes 30 minutes to Guangzhou and 2 hours to Shenzhen/Hong Kong. We are a leading manufacturer of all k... Đọc thêm »
  • Máy móc bao bì
  • Foshan
  • Trung Quốc
supplyautonomy.com/excellpacks.in
Welcome Empowering people through prosperity and helping them create wealth have been the mission of VK Engineering & Company since 2000 VK Engineering & Company and heir... Đọc thêm »
  • Bao bì và đóng gói - máy móc thiết bị | Máy móc và thiết bị đóng gói | Máy móc bao bì | Xem Máy móc bao bì | Máy đóng gó...
  • Coimbatore, Tamil Nādu
  • Ấn Độ
supplyautonomy.com/cooltechenterprises.in
A renowned name in the domain of Cooling Pads, ABS Ductable Cooling Machine, Desert/Room Coolers, etc., Cool Tech Enterprises has been offering quality to the clients. Combining technology and wide... Đọc thêm »
  • An ninh Đại lý sản phẩm | Chuyển In ấn | Dịch vụ tiêm đúc, kim loại | Vật liệu cách nhiệt | Tùy chỉnh thiết kế lò xo | K...
  • Amravati
  • Ấn Độ
supplyautonomy.com/chamundaindustries.in
We are pleased to introduce ourselves as one of the leading Exporters, Manufacturers , Stockists Supplier of stainless steel item,ferrous non-ferrous metal which are required by your company in... Đọc thêm »
  • An ninh Đại lý sản phẩm | Chuyển In ấn | Dịch vụ tiêm đúc, kim loại | Vật liệu cách nhiệt | Tùy chỉnh thiết kế lò xo | K...
  • Mumbai
  • Ấn Độ
supplyautonomy.com/preciousmineralprocessingsystemspvt.in
CHITRA PHARMA MACHINERY PRECIOUS FAB-CAST PVT. LTD. , the parent company of CHITRA PHARMA MACHINERY-an ISO 9001: 2000 company is the designer, developer, manufacturer and exporter of various... Đọc thêm »
  • Thiết bị làm sạch | Cây công nghiệp thực phẩm và thiết bị nes | Máy móc thiết bị khoan giếng | Máy công cụ gia công kim ...
  • Ahmedabad
  • Ấn Độ
supplyautonomy.com/kusodalamuthucopvt.in
Bharath Paper Conversions are manufacturers and exporters of high quality Paper Cones, Paper Tubes, Paper Cores, Edge Protectors, Composite Cans and Pulp Moulded Products. Established in 1984, the... Đọc thêm »
  • Khay, ván sợi ép | Ống, giấy hay ván sợi ép | Ống, giấy hay ván sợi ép, vết thương | Ống, ván sợi ép, lót | Ống, strawbo...
  • Coimbatore
  • Ấn Độ
supplyautonomy.com/seniorprintpackmachineryco.in
Manufacturers & Exporters Of Corrugated Board, Box Making Machinery, Corrugated Board Making Plant, Die Punching, Cutting, Creasing & Embossing Machine, Hot Foil Stamping Die Cutting... Đọc thêm »
  • Làm túi Máy móc | In ấn và thiết bị đồ họa | Giấy máy móc thiết bị phân loại | Máy đặt (layboys), giấy chuyển đổi | Máy ...
  • Hyderabad
  • Ấn Độ
supplyautonomy.com/finopack.cn
An open mouth bagging machine is an automatic filling and sealing machine which fills products into bags up to a specific weight, and closes the bag mouth automatically. Our automatic bagging and... Đọc thêm »
  • Máy móc và thiết bị đóng gói | Máy móc bao bì | Xem Máy móc bao bì
  • Hefei
  • Trung Quốc