కోసం శోధన ఫలితాలు: ప్యాకేజింగ్ యంత్రాలు
దొరకలేదు 4346 కంపెనీలుsupplyautonomy.com/trustarpharmapackingequipment.cn
Wenzhou Trustar Machinery Technology co.,ltd.is located in Ruian, Wenzhou, the capital of packaging and printing. The factory covers an area of about 7000 square meters and the office building area... మరింత చదవండి »
- ప్యాకేజింగ్ యంత్రాలు
- Wenzhou
- చైనా
supplyautonomy.com/tangshankingvidaprintingmachineryco.cn
The outstanding Tangshan Kingvida Printing Machinery Co., Ltd. is a professional manufacturer of printing and packaging machinery. Located in the central area of Beijing,Tianjin and Tangshan.The... మరింత చదవండి »
- పేపర్ కట్టింగ్ - యంత్రములు మరియు పరికరములు | ప్యాకేజింగ్ యంత్రాలు | కార్టన్ యంత్రాలు మడవటం మరియు glueing...
- Yutian County
- చైనా
supplyautonomy.com/zhejiangruianyongtaipackingmachinerymanufactureco.cn
Zhejiang Ruian Yongtai Packing Machinery Manufacture Co., Ltd is specialized in producing complete sets of flexible packaging equipment and has a long history. We specially produce various plastic... మరింత చదవండి »
- బ్యాగ్ యంత్రాలు తయారు | బ్యాగ్ యంత్రాలు భాగాలు తయారు | ప్రింటింగ్ యంత్రాలు | ముడతలు పెట్టబడిన అట్ట ప్యాకేజీ యంత్రాలను తయ...
- Wenzhou
- చైనా
supplyautonomy.com/guangdongqishengmachineryco.cn
supplyautonomy.com/lindumpackaging1.gb
We analyse what constraints are preventing our customers from achieving optimum efficiency. We know that they need the right products, in the right place, at the right time.
Production Can’t Stop ... మరింత చదవండి »
- ప్యాకేజింగ్ పరిశోధన కన్సల్టెంట్స్ | ప్యాకేజీలు మరియు పాకేజింగ్ సామాగ్రికి పరీక్ష | ప్యాకేజింగ్ సేవలు | కేసులు పెట్టెలుతో...
- Stallingborough, North East Lincolnshire
- బ్రిటన్
supplyautonomy.com/soonkpackagingmachine.cn
Foshan Soonk Packaging Machine Co., Ltd. is a professional advanced enterprise engaged in packaging machine research and development, design, production, sales and maintenance.
- ప్యాకేజింగ్ యంత్రాలు మరియు పరికరాలు, రెండవ చేతి | మూసివేస్తారు మరియు చుట్టడం - యంత్రములు మరియు పరికరములు | ప్యాకింగ్ మరి...
- Foshan
- చైనా
supplyautonomy.com/tubitexspa.it
supplyautonomy.com/antoniodominicifratellicostruzionimeccanichesrl.it
Production of machinery for the baking and food industries. Robotized systems for handling, chocolate egg wrappers, chocolate coin wrappers, nougat cookers and cutters, bakery machinery, automatic... మరింత చదవండి »
- రొట్టె మరియు పాస్ట్రీ తయారీలో యంత్రాలు కండరముల పిసుకుట / పట్టుట | మిఠాయి, యంత్రాలు మరియు పరికరాలు కండరముల పిసుకుట / పట్ట...
- Perugia
- ఇటలి
supplyautonomy.com/bidllc.ua
BID company - Pasta and packaging equipment manufacture
Dear Sirs!
The distinctive mark of our company is a wide range of pasta, drying and packaging equipment, which allows to produce pasta... మరింత చదవండి »
- రొట్టె మరియు పాస్ట్రీ తయారీలో యంత్రాలు కండరముల పిసుకుట / పట్టుట | ఆహార పరిశ్రమ మొక్క మరియు పరికరాలు NES | యంత్రాలు స్టాక...
- Dnepropetrovsk
- యుక్రెన్
supplyautonomy.com/rakshapackaging.in
The company formed in the year 1976 as a-class ancillary suppliers diversified into the field of packaging by the name of Raksha Packaging in the year 1994.
The growth in packaging industry is far... మరింత చదవండి »
- పిజ్జా డెలివరీ కోసం వాహకాలు, ప్లాస్టిక్, | ఆహార పదార్థాలు కోసం సినిమా, ప్లాస్టిక్, | ఆహార పదార్థాలు సంచులు, ప్లాస్టిక్, ...
- Faridabad
- భారత దేశం
supplyautonomy.com/riddhipharmamachinery.in
Manufacturers and Exporters of Pharmaceutical Machineries. Our multitude of products include Pharmaceutical Machinery, Tablet Press Machine, Rotary Tablet Press Machine, Fluid Bed Dryer, Tray drier,... మరింత చదవండి »
- ఆహార పరిశ్రమ మొక్క మరియు పరికరాలు NES | EXTRUDERS, ఔషధ మరియు అలంకరణ పరిశ్రమలు | చమురు శుద్ధి కర్మాగారం, ఔషధ మరియు అలంకరణ...
- Mumbai
- భారత దేశం
supplyautonomy.com/acmemachineryindiapvt.in
Acme Machinery (India) Pvt. Ltd. is a professionally managed organization accredited for manufacturing and exporting of Paper Board Printing, Packaging and Converting Machineries since... మరింత చదవండి »
- కార్డ్బోర్డ్ తయారు యంత్రాలు, నిరంతర, సిలిండర్ | Moulds, సిలిండర్, కార్డ్బోర్డ్ మేకింగ్ | పరచుట యంత్రాలు, కార్డ్బోర్డ్ మర...
- Mumbai
- భారత దేశం
supplyautonomy.com/gdspa.it
G.D is the world's leading cigarette production and packaging machinery constructor. Its vast array of solutions makes G.D. the only company in a position to offer complete high-speed lines.
- Moisturisers, పాదరక్షలు తయారీ | కట్ పొగాకు కోసం చల్లబరిచే ప్లాంట్ | కండెన్సర్లు, వర్ణంలోని చమురు మరియు కొవ్వు ఉత్పత్తి |...
- Bologna
- ఇటలి
supplyautonomy.com/reconmachinetoolspvt.in
Recon is a leading manufacturer of Plant and Machinery for Metal Cans, Metal Closures Steel Drums, also complete packaging lines for powder, liquid paste in metal containers.
Established in the... మరింత చదవండి »
- మిశ్రమ యంత్రాలు తయారు చేసుకోవచ్చు | అందిస్తున్నట్లు వ్యవస్థలు, చెయ్యవచ్చు మరియు మూత చెయ్యవచ్చు | మరియు పిపా శుభ్రపరిచే మ...
- Mumbai
- భారత దేశం
supplyautonomy.com/assopackmachines.in
We have created a niche among quality-oriented corrugators. Our name inspires confidence not only among Indian corrugators but it is known for its reliability of its products in foreign markets... మరింత చదవండి »
- , మెలికలు మూసివేయటం rewinding యంత్రాలు, మేకింగ్ | వైన్డింగ్, rewinding మరియు కట్టింగ్ యంత్రాలు, బహుళ కార్యాచరణ, మేకింగ్...
- Ahmedabad
- భారత దేశం
supplyautonomy.com/gangasinghengineeringpvt.in
ESSGEE Exports is a proprietary concern established in 1993 and are very strong in exporting machinery which are mainly used in tin container industry, packaging industries and having vast knowledge... మరింత చదవండి »
- బిల్డర్ల 'టూల్స్ | ఆహార పరిశ్రమ మొక్క మరియు పరికరాలు NES | బాగా డ్రిల్లింగ్ యంత్రాలు | ఇతర నూలు యంత్రాలను | వైర్ డ్రాయి...
- Mumbai
- భారత దేశం
supplyautonomy.com/apsaraengineers.in
We the manufacturers and exporters of all kinds of textile related machinery, we are specialist in polyfill opening machinery, pillow packing machinery and blowfill machines in nominal cost.
We... మరింత చదవండి »
- నూలు యంత్రాలను కోసం Spools, బోబిన్స్ను శంకువులు, ప్లాస్టిక్, | స్పిన్నింగ్ గొట్టాలు, ప్లాస్టిక్ | స్పిన్నింగ్ యంత్రాలు క...
- Coimbatore
- భారత దేశం
supplyautonomy.com/foshancitycoretamppackingmachineryco.cn
Foshan Coretamp Packaging Machinery Co.,Ltd. is located in China Machinery Center - Foshan city, takes 30 minutes to Guangzhou and 2 hours to Shenzhen/Hong Kong. We are a leading manufacturer of all k... మరింత చదవండి »
- ప్యాకేజింగ్ యంత్రాలు
- Foshan
- చైనా
supplyautonomy.com/excellpacks.in
Welcome
Empowering people through prosperity and helping them create wealth have been the mission of VK Engineering & Company since 2000
VK Engineering & Company and heir... మరింత చదవండి »
- ప్యాకింగ్ మరియు ప్యాకేజింగ్ - యంత్రములు మరియు పరికరములు | ప్యాకేజింగ్ యంత్రాలు మరియు పరికరాలు | ప్యాకేజింగ్ యంత్రాలు | ప...
- Coimbatore, Tamil Nādu
- భారత దేశం
supplyautonomy.com/cooltechenterprises.in
A renowned name in the domain of Cooling Pads, ABS Ductable Cooling Machine, Desert/Room Coolers, etc., Cool Tech Enterprises has been offering quality to the clients. Combining technology and wide... మరింత చదవండి »
- సెక్యూరిటీ ఉత్పత్తి ఎజెంట్ | బదిలీ ముద్రణ | ఇంజెక్షన్ మౌల్డింగ్ సేవలు, మెటల్ | ఇన్సులేషన్ పదార్థాలు | కస్టమ్ డిజైన్ SPR...
- Amravati
- భారత దేశం
supplyautonomy.com/chamundaindustries.in
We are pleased to introduce ourselves as one of the leading Exporters, Manufacturers , Stockists Supplier of stainless steel item,ferrous non-ferrous metal which are required by your company in... మరింత చదవండి »
- సెక్యూరిటీ ఉత్పత్తి ఎజెంట్ | బదిలీ ముద్రణ | ఇంజెక్షన్ మౌల్డింగ్ సేవలు, మెటల్ | ఇన్సులేషన్ పదార్థాలు | కస్టమ్ డిజైన్ SPR...
- Mumbai
- భారత దేశం
supplyautonomy.com/preciousmineralprocessingsystemspvt.in
CHITRA PHARMA MACHINERY
PRECIOUS FAB-CAST PVT. LTD. , the parent company of CHITRA PHARMA MACHINERY-an ISO 9001: 2000 company is the designer, developer, manufacturer and exporter of various... మరింత చదవండి »
- పరికరాలు క్లీనింగ్ | ఆహార పరిశ్రమ మొక్క మరియు పరికరాలు NES | బాగా డ్రిల్లింగ్ యంత్రాలు | మిల్లింగ్ మెటల్ కోసం యంత్ర పరిక...
- Ahmedabad
- భారత దేశం
supplyautonomy.com/kusodalamuthucopvt.in
Bharath Paper Conversions are manufacturers and exporters of high quality Paper Cones, Paper Tubes, Paper Cores, Edge Protectors, Composite Cans and Pulp Moulded Products. Established in 1984, the... మరింత చదవండి »
- పాత్రలు, FIBREBOARD | గొట్టాలు, కాగితం లేదా FIBREBOARD | గొట్టాలు, కాగితం లేదా FIBREBOARD, గాయం | గొట్టాలు, FIBREBOARD, ...
- Coimbatore
- భారత దేశం
supplyautonomy.com/seniorprintpackmachineryco.in
Manufacturers & Exporters Of Corrugated Board, Box Making Machinery, Corrugated Board Making Plant, Die Punching, Cutting, Creasing & Embossing Machine, Hot Foil Stamping Die Cutting... మరింత చదవండి »
- బ్యాగ్ యంత్రాలు తయారు | ప్రింటింగ్ మరియు గ్రాఫిక్స్ పరికరాలు | పేపర్ విభజన యంత్రాలు మరియు పరికరాలు | వేసాయి యంత్రాలు (la...
- Hyderabad
- భారత దేశం
supplyautonomy.com/finopack.cn
An open mouth bagging machine is an automatic filling and sealing machine which fills products into bags up to a specific weight, and closes the bag mouth automatically. Our automatic bagging and... మరింత చదవండి »
- ప్యాకేజింగ్ యంత్రాలు మరియు పరికరాలు | ప్యాకేజింగ్ యంత్రాలు | ప్యాకేజింగ్ యంత్రాలు పార్టులు...
- Hefei
- చైనా