Loading...
Resultats de la cerca per a: Maquinària d'embalatge
Empreses 4346 trobatssupplyautonomy.com/safetypackagingsealingmachineries.in
Introducing a comprehensive range of Pouch Sealing Machines, Bag Closing Machines, Box Strapping Machines, Continuous Band Sealer with Nitrogen Gas Flushing System [Vertical & Horizontal Type],... Llegir més »
- Maquinària d'embalatge
- Hyderabad
- Índia
supplyautonomy.com/eastragoninternationaltradeco.cn
Established in 2005, Eastragon International Trade Co., Ltd. is a professional foreign trade company with head office located in the developed city of Jiangyin, which is close to China's... Llegir més »
- Eines de neteja | Maquinària d'embalatge
- Jiangyin
- Xina
supplyautonomy.com/rishikeshexports.in
- Magranes fresques | Planta de la indústria alimentària i cions equip | Maquinària d'embalatge | Jocs i joguines de fu...
- Thane
- Índia
supplyautonomy.com/rkengineering2.in
R.K. Engineering was born out of the academic brilliance and engineering expertise of a core team of technocrats. R.K. Engineering is by now a renowned name in pharmaceutical and chemical industries... Llegir més »
- Maquinària d'embalatge | Màquina d'envasat de productes farmacèutics
- Mumbai
- Índia
supplyautonomy.com/packsolindustries.in
The pramukh industries range of form-fill-seal machines are available in many models depending on the material being filled and the speed required. It can fillseal PVC or laminated sheets in pouches... Llegir més »
- Maquinària per a la mineria usats | Maquinària d'embalatge
- Vasai
- Índia
supplyautonomy.com/marsonsprintgrafmachinespvt.in
- Adhesius i cintes | Premsa i equips gràfics | Màquina d'impressió de gravat al buit | Maquinària d'embalatge | Làmines d...
- Mumbai
- Índia
supplyautonomy.com/shreechamundamicroindustries.in
Showcasing supreme quality Packing Machine, Automatic Packing Machine, Form Fill & Sealing Machine based Cup Systems, Semi-automatic Liquid Filling Machines, Horizontal Flow Wrapping Machines,... Llegir més »
- Maquinària d'embalatge
- Ahmedabad
- Índia
supplyautonomy.com/swanpackpackagingmachinespvt.in
Packaging enhances the look of the product and enables in retaining the quality of the product for longer time. Comprehending the increasing need for these, we Swanpack Packaging Machine, deal in... Llegir més »
- Maquinària d'embalatge
- Hyderabad
- Índia
supplyautonomy.com/ramoliaenterprise.in
A name you can bank upon, Ramolia Enterprise is one of the key Suppliers, Traders and Service Providers of a wide range of electrical products. Our array of products includes Electrical Air Vessels,... Llegir més »
- Maquinària d'embalatge | Compressors i equip associat
- Ahmedabad
- Índia
supplyautonomy.com/pawantradingco.in
With our excellent performance in the arena of Precision Spares and Machineries, we are a well-known brand by the name o.
- Maquinària d'embalatge
- Kolkata
- Índia
supplyautonomy.com/omgajananpackaging.in
In the recent time, the packaging industry has witnessed a steep growth, and eventually need of custom built packaging machines are needed for the packaging industry. With our years of expertise and... Llegir més »
- Productes de plàstic | Maquinària d'embalatge
- Pune
- Índia
supplyautonomy.com/nmcengineers.in
Company Brief NMC Engineers is a trusted printing and sheeting machineries Importer, Trader, Exporter & Manufacturer, with a proven track record in the industry. Since inception in 2000, the... Llegir més »
- Maquinària d'embalatge
- New Delhi
- Índia
supplyautonomy.com/starengineeringworks.in
Providing a wide range of Corrugation Machines, Corrugated Box Machine, Printing Machines, Flexo Printing Machines, Die Cutting Machines, etc. The engineering excellence and adroit professionals... Llegir més »
- Maquinària d'embalatge
- Amritsar
- Índia
supplyautonomy.com/vijayenterprise2.in
Background & Location: Vijay Enterprise-A Vijaypack Group Company is a fast growing Kolkata, West Bengal (India) based company. Established in the year 1985, we are engaged in Manufacturing,... Llegir més »
- Maquinària d'embalatge
- Kolkata
- Índia
supplyautonomy.com/kcsonpharmamachinery.in
Offering a wide range of Pharmaceutical Machines such as Mass Mixer, Fluid Bed Drying, Pressure Vessel, Store/Mixing Tank, Colloid Mill, Semi Automatic Liquid Filling Machine, etc....Through... Llegir més »
- Maquinària d'embalatge
- Ahmedabad
- Índia
supplyautonomy.com/jangircompany.in
Manufacturers & Exporters of BOPP Self Adjesive Tape Plant, PVC Insulation Tape Plant, Roto Gravure Printing, Flaxo, Slitting Rewinding, Micro Slitting Rewinding, Stainary Tape Slitting... Llegir més »
- Net i pel · lícula, polimèric, per a aplicacions mèdiques i higiene | Adhesius i cintes | Maquinària d'embalatge
- New Delhi
- Índia
supplyautonomy.com/nlkengineering.in
Bringing forth an array of well fabricated printing machines, lamination machines, slitting machines, doctorine machines, etc. exhibiting excellence in quality and technology.....Today, machines play... Llegir més »
- Maquinària d'embalatge
- Kolkata
- Índia
supplyautonomy.com/vinerajenterprise.in
Avail With Us Is A Durable Range Of Weighing Systems, Industrial Machines, Conveyors, Elevators, Vibrating Screens And Heavy & Light Duty Structures. We, Vineraj Enterprise, are a reputed ... Llegir més »
- Impressores, fotografia | Maquinària d'embalatge | Balances
- Vadodara
- Índia
supplyautonomy.com/sigmapackagingsolutions.in
Offering a wide range of Bottling Line & Automatic Packaging Line such as Automatic Rinser / Filler/ Capper With Cap Elevator, Automatic Hotmelt Labeller, Semi Automatic Hot Melt Labeller, Semi... Llegir més »
- Maquinària d'embalatge
- Vasai
- Índia
supplyautonomy.com/newtechindustries.in
With our about two and a half decades domain experience and comprehensive expertise, we, New-Tech Industries, have been catering to packaging & filling needs of varied industries. Our products... Llegir més »
- Maquinària d'embalatge
- Ahmedabad
- Índia
supplyautonomy.com/mukulengineeringenterprise.in
Leveraging on the state-of-the-art technology and consistent efforts of our team, we, Mukul Engineering Enterprise, have marked our permanence in the national business domain. Incepted in the year... Llegir més »
- Màquines eina per fresar metalls | Maquinària d'embalatge
- Madanpur
- Índia
supplyautonomy.com/thedeccanpackagingsystemsandneeds.in
An accomplice set to innovate FFS packaging machines with high precision and quality standards... A globally reputed company, The Deccan Packaging Systems and Needs is an integral part of the most... Llegir més »
- Maquinària d'embalatge
- Hyderabad
- Índia
supplyautonomy.com/vjwaterconceptsip.in
Water purification and management is a crucial practice that is taken care of in almost every commercial or industrial organizations, even in domestic front, water purification is an important... Llegir més »
- Maquinària d'embalatge
- Mumbai
- Índia
supplyautonomy.com/cristalaquasystems.in
Preserving the most precious gift of nature with latest technological innovations.... Water is the most precious resource that the nature has endowed on humanity, and 70 % of earth is draped with... Llegir més »
- Maquinària d'embalatge
- Chennai
- Índia
supplyautonomy.com/shreegajanmetalindustries.in
- Acoblaments | Equips de Neteja | Dibuix de filferro i màquines de treball de fil de màquina | Motlles | Maquinària d'...
- Ahmedabad
- Índia
supplyautonomy.com/adlerexports.in
- Papereria | Subministraments de jardineria | Màquines de perforació de pous | Maquinària d'embalatge | Equip mèdic
- Rajkot
- Índia
supplyautonomy.com/creedengineerspvt.in
- Agents de productes d'embalatge | Premsa i equips gràfics | Maquinària d'embalatge | Impresos i productes relacionats | ...
- Gurgaon
- Índia
supplyautonomy.com/hardabarteryhouse.in
- Blat | Pantalons i pantalons | Moneders | Productes de plàstic | Maquinària d'embalatge | Roba per a senyores | Roba
- Veraval
- Índia
supplyautonomy.com/dolphinprocessautomationpvt.in
- Consultoria de gestió | Material electrònic | Equip de soldadura | Maquinària d'embalatge | Serveis d'educació
- Gurgaon
- Índia
supplyautonomy.com/waradeautomationsolutions.in
Dealers of All Types of Conveyors, Belt Conveyors, Modular Conveyors, Roller Conveyors, Power Conveyors, Robots.
- Cintes transportadores, fibrociment | Productes de fibrociment, resistència al foc | Maquinària d'embalatge
- Pune
- Índia