Loading...
Вынікі пошуку для: Ўпаковачная абсталяванне
Знойдзеныя 4346 кампанііsupplyautonomy.com/pawantradingco.in
With our excellent performance in the arena of Precision Spares and Machineries, we are a well-known brand by the name o.
- Ўпаковачная абсталяванне
- Kolkata
- Індыя
supplyautonomy.com/shreejiprojects.in
supplyautonomy.com/royalpackindustries.in
Royal Pack Industries was incepted in the year 2003, as a manufacturer, importer, exporter, supplier and trader of various packaging machinery. We have a large line of products in which, we offer... Больш падрабязна »
- Ўпаковачная абсталяванне
- Mumbai
- Індыя
supplyautonomy.com/packsolindustries.in
The pramukh industries range of form-fill-seal machines are available in many models depending on the material being filled and the speed required. It can fillseal PVC or laminated sheets in pouches... Больш падрабязна »
- Патрыманыя горназдабыўныя механізмы | Ўпаковачная абсталяванне
- Vasai
- Індыя
supplyautonomy.com/mectropack.in
MECTROPACK. Specialized in all types of pouch and carton packaging machine manufacturing, company
Our product include manufacturer exporter of all types of packing like powder packing machine,... Больш падрабязна »
- Ўпаковачная абсталяванне
- Faridabad
- Індыя
supplyautonomy.com/marsonsprintgrafmachinespvt.in
- Клеі і стужкі | Абсталяванне для друку і дызайну графічнага | Глыбокія друкаваныя машыны | Ўпаковачная абсталяванне | Фа...
- Mumbai
- Індыя
supplyautonomy.com/grafikmachineryexchangeindia.in
Most advanced technology and best products at great prices; since 1989... Grafik Machinery Exchange India is a well known brand in the printing industry for its technical wizardry. We were ... Больш падрабязна »
- Ўпаковачная абсталяванне
- New Delhi
- Індыя
supplyautonomy.com/drmachinetools.in
D.R. Machine Tools is a highly recognized manufacturer, supplier and exporter offering unmatched Pilfer Proof Caps making Machinery. Incorporated in the year 1996, the company has carved a special... Больш падрабязна »
- Ўпаковачная абсталяванне
- New Delhi
- Індыя
supplyautonomy.com/stitchexpertsindia.in
We, Stitch Experts India, are one of the leading companies in the domains of bag handling systems since our formation in 1992. With years of industry knowledge and experience to offer increased... Больш падрабязна »
- Ўпаковачная абсталяванне
- New Delhi
- Індыя
supplyautonomy.com/jmcpapertechpvt.in
An eminent company exhibiting expertise in providing premium quality machines like Pulper with Belt Conveyor, JMC Hi Consistency Pulper, Turbo Separator, M.G. Cylinder, Paper Machine Dryer Section,... Больш падрабязна »
- Ўпаковачная абсталяванне
- Ahmedabad
- Індыя
supplyautonomy.com/vjstrappingsystems.in
To cater to the requirements of packaging and other industries, we, VJ STRAPPING SYSTEMS are dedicated in providing various machinery and other packaging materials to the clients. Started in the year... Больш падрабязна »
- Клеі і стужкі | Ўпаковачная абсталяванне
- Yanam
- Індыя
supplyautonomy.com/friendspackaging.in
Our consistent growth has spanned the period of 15 years, during which we have unveiled a number of leading-edge innovations, and acquired the distinguished expertise in our field. Friends Packaging... Больш падрабязна »
- Ўпаковачная абсталяванне
- Faridabad
- Індыя
supplyautonomy.com/shreechamundamicroindustries.in
Showcasing supreme quality Packing Machine, Automatic Packing Machine, Form Fill & Sealing Machine based Cup Systems, Semi-automatic Liquid Filling Machines, Horizontal Flow Wrapping Machines,... Больш падрабязна »
- Ўпаковачная абсталяванне
- Ahmedabad
- Індыя
supplyautonomy.com/swanpackpackagingmachinespvt.in
Packaging enhances the look of the product and enables in retaining the quality of the product for longer time. Comprehending the increasing need for these, we Swanpack Packaging Machine, deal in... Больш падрабязна »
- Ўпаковачная абсталяванне
- Hyderabad
- Індыя
supplyautonomy.com/ramoliaenterprise.in
A name you can bank upon, Ramolia Enterprise is one of the key Suppliers, Traders and Service Providers of a wide range of electrical products. Our array of products includes Electrical Air Vessels,... Больш падрабязна »
- Ўпаковачная абсталяванне | Кампрэсары і сумежных абсталявання
- Ahmedabad
- Індыя
supplyautonomy.com/dolphinprocessautomationpvt.in
- Кансалтынг па кіраванні | Электронныя аксэсуары | Зварка | Ўпаковачная абсталяванне | Паслугі ў галіне адукацыі...
- Gurgaon
- Індыя
supplyautonomy.com/omgajananpackaging.in
In the recent time, the packaging industry has witnessed a steep growth, and eventually need of custom built packaging machines are needed for the packaging industry. With our years of expertise and... Больш падрабязна »
- Вырабы з пластыка | Ўпаковачная абсталяванне
- Pune
- Індыя
supplyautonomy.com/rdsingalco.in
R. D. Singal & Co, "The Admired & The Reliable", has been serving as a packaging solution provider and has made substantial inroads on the packaging industry. We at R. D. Singal... Больш падрабязна »
- Ўпаковачная абсталяванне
- Delhi
- Індыя
supplyautonomy.com/nandaelectricals.in
World class heating elements at highly competitive price...Backed with 35 years of rich industry experience, we have come through some brilliant phases of success and development to be the leading... Больш падрабязна »
- Ўпаковачная абсталяванне
- Amritsar
- Індыя
supplyautonomy.com/koleyconvertingmachinerypvt.in
We are manufacturer, supplier and exporter of rotogravure printing machine, rotogravure printing press, high speed rotogravure printing press and high speed rotogravure printing machines.
- Ўпаковачная абсталяванне
- Howrah
- Індыя
supplyautonomy.com/superpackpackagingmachinespvt.in
With rich experience of more than a decade, Superpack Packaging Machines Pvt. Ltd. commenced business in the year 1995, and since then we have been a renowned manufacturer, exporter and supplier of L... Больш падрабязна »
- Ўпаковачная абсталяванне
- Hyderabad
- Індыя
supplyautonomy.com/shreejishrinksystem.in
We the manufacturer and exporter of packaging machinery, food packaging machinery, vacuum packaging machinery, shrink packaging machinery, packaging machinery company, we also offer carton packaging... Больш падрабязна »
- Ўпаковачная абсталяванне
- Mumbai
- Індыя
supplyautonomy.com/ishidaindiapvt.in
Established in the year 2007, Ishida India Pvt. Ltd. has rapidly made its name a reckoned one in the entire industry. With commendable performance in a few years, we have carved a distinct niche in... Больш падрабязна »
- Ўпаковачная абсталяванне
- Gurgaon
- Індыя
supplyautonomy.com/brotherspharmamach.in
- Абсталяванне для ачысткі | Ўпаковачная абсталяванне | Маишна ўпакоўкі лекі...
- Ahmedabad
- Індыя
supplyautonomy.com/ethioplasticspvt.in
supplyautonomy.com/goldenmachinexcorporation.in
A time honored organization, with an experience that sprawls across half a century, we, Golden Machinery Corporation, are one of the most reputed names throughout the Indian subcontinent. As a... Больш падрабязна »
- Бурэнне свідравін | Ўпаковачная абсталяванне
- Kolkata
- Індыя
supplyautonomy.com/sensotechweighingsystems.in
The in-depth domain knowledge and support of latest process technology allow Sensotech Weighing Systems to serve quality conscious customers with complete range of weighing products. Incepted in the... Больш падрабязна »
- Электронныя аксэсуары | Ўпаковачная абсталяванне | Платформенныя шалі...
- Indore
- Індыя
supplyautonomy.com/adlerexports.in
- Канцтавары | Прыналежнасці для садоўніцтва | Бурэнне свідравін | Ўпаковачная абсталяванне | Медыцынскае абсталяванне...
- Rajkot
- Індыя
supplyautonomy.com/creedengineerspvt.in
- Агенты па прадуктах ўпакоўкі | Абсталяванне для друку і дызайну графічнага | Ўпаковачная абсталяванне | Друкаваная і род...
- Gurgaon
- Індыя
supplyautonomy.com/hardabarteryhouse.in
- Пшаніца | Шорты і штаны | Кашалькі | Вырабы з пластыка | Ўпаковачная абсталяванне | Адзенне жаночая | Адзенне...
- Veraval
- Індыя