תוצאות חיפוש עבור: מכונות אריזה

חברות 7630 נמצאו

נושא


supplyautonomy.com/pentagonmarketing.in
Available in various dimensions, specifications, capacities, efficiency, etc, packaging machinery find applications in various industries like chemical, marine, food, etc. Pentagon Marketing is... קראו עוד »
  • מדפסות, תצלום | עטי מרקר | דבקים וקלטות | מכונה אריזה
  • Kochi
  • הודו
supplyautonomy.com/taisunmachinery.tw
Tai sun machinery Co., ltd has been concentrating on the manufacture of the tissue paper converting machine since 1970. Now the "tai sun" brand has successfully exported A big quantity of... קראו עוד »
  • מגבת ביצוע מכונות | מכונה אריזה
  • Taipei
  • טייוואן
supplyautonomy.com/iterrainintlenterprisesco.tw
In the manufacture of those machines we use the most advanced modern techniques. We take pride in having offered the overseas markets products of unsurpassed quality and appearance for the 27 years.... קראו עוד »
  • פולי קפה, Java | מכונה ששימוש אחר | מכונה אריזה
  • Taichung
  • טייוואן
supplyautonomy.com/masaelimachinemanufacturing.ir
Masaeli Industry Machinery is a leading company is Iran`s packing industry founded in 1983.Our main products include pillow packing machines that are suitable for packing all of things in different... קראו עוד »
  • מכונה אריזה | קו אריזה
  • Esfahan
  • איראן
supplyautonomy.com/ptsancoindonesia.id
Sanco international based in Jakarta, Indonesia is a marketing arms company that owns an exclusive right to promote and to distribute end products from manufacturer of confectionery products in... קראו עוד »
  • הקפסולה מילוי המכונה | מכונה אריזה
  • Jakarta
  • אינדונזיה
supplyautonomy.com/baodingjialifoodmachine.cn
Established in 1998, Baoding Jiali Food Machine Co.,ltd is a professional manufacturer engaged in research, development, production, sale and service of all kinds of food machines. Excellent... קראו עוד »
  • מפעל תעשיית מזון וציוד נס | מכונה אריזה
  • Baoding
  • סין
supplyautonomy.com/zhejiangruianyongxinmachineryfactory.cn
Ruian Yongxin Machinery Factory is located in Ruian, Zhejiang province, the famous City of Packaging Machinery in China. It always devotes itself to researching and developing packaging or... קראו עוד »
  • מכונה תרופות אחרות | מכונה אריזה
  • Ruian
  • סין
supplyautonomy.com/zhangjiagangkingstepmachineryco.cn
Our quality products are: Pure/Mineral water production lines Carbonated drink production lines; Fruit juice production lines Tea drink production lines Soy milk and protein drink production... קראו עוד »
  • מים טהורים | מכונה אריזה
  • Suzhou
  • סין
supplyautonomy.com/nissionfoodmachinerycorporation.cn
Qingdao Nissin Food Machinery Co., Ltd. is a Sino-Japanese joint venture established in 1989. Our company applies complete Japanese technology, blueprints and components and works together with... קראו עוד »
  • מכונות חטיפים | מכונה אריזה
  • Qingdao
  • סין
supplyautonomy.com/hbfpt.cn
Our company originates at the beginning of the 1990. Our predecessor is the Shijjiazhuang Changan Stainless Steel Plant, with the registered capital of 1,800,000 and a staff of 70 people. Our... קראו עוד »
  • מפעל תעשיית מזון וציוד נס | הרם שולחנות | מכונה אריזה | סטייפלס, חוט
  • Shijiazhuang
  • סין
supplyautonomy.com/guangzhouhaochiwoodworkingmachineryco.cn
Guangzhou JianChi Woodworking Machinery Co., Ltd. locates in ShaWan Town, Panyu Area, Guangzhou City. We have been insisting on the aim of "survive with quality and develop with... קראו עוד »
  • מכונה אריזה | ציוד לעיבוד עץ
  • Guangzhou
  • סין
supplyautonomy.com/greatelectricsmachineco.cn
Since our establishment in 1989, Great-Electrics Machine Co., Ltd. has been the leading manufacturer in the thermoforming machine industry in China. We have a strong research and development team to... קראו עוד »
  • ציוד ריתוך | רתכים פלסטיק | מכונה אריזה | מגשי ביצים
  • Guangzhou
  • סין
supplyautonomy.com/jayengineeringcombine.in
Standard spares and machineries for soap, detergent, chemicals HVAC Plants JAY ENGINEERING... קראו עוד »
  • מכונה אריזה
  • Ahmedabad
  • הודו
supplyautonomy.com/bossengineeringcompany.in
Backed by industry experience of about a decade, we are engaged in manufacturing a completely automatic range of machines used in filling, capping, and labeling of bottles and containers. Our range... קראו עוד »
  • מכונה אריזה | מכונת אריזת תרופות | חומרי אריזה אחרים
  • Ahmedabad
  • הודו
supplyautonomy.com/shreejipharmatech.in
About Us Shreeji Pharmatech is one of the pioneering manufacturers of a wide range of Pharmaceutical Machineries like Dry Injectable Powder Filling Machine, Semi-automatic Dry Injectable Powder... קראו עוד »
  • מכונה טקסטיל אחר | מכונה אריזה
  • Ahmedabad
  • הודו
supplyautonomy.com/masterfil.gb
The Adelphi Group of Companies has served customers all over the world for over 60 years. Our products range form simple stainless steel vessels to complete turnkey filling and capping lines, all... קראו עוד »
  • אריזה ואריזה - מכונות וציוד | תופים, דליים וחביות
  • Aylesbury
  • בריטניה
supplyautonomy.com/susmatexmachinery.in
Dear Visitors and customers, First of all, we would like to tell thanks to visitors and customers who visiting our website, so we are greatly pleased to introduce our company and our products to... קראו עוד »
  • מכונות תחרה | מכונה אריזה
  • Ahmedabad
  • הודו
supplyautonomy.com/omchamundaenterprises.in
A om chamunda enterprisesis one of the leading manufacturer, exporter and supplier of packaging machine from India. Designed for efficient operation to meet the varying requirements of different... קראו עוד »
  • הקפסולה מילוי המכונה | מכונה אריזה
  • Mumbai
  • הודו
supplyautonomy.com/shrivinayakpackagingmachinepvt.in
Incorporated in the year 2000, Shri Vinayak Print-Pack is a leading importer and supplier of packaging machines. The range includes semi / fully automatic packaging machines, strapping machines,... קראו עוד »
  • מכונה אריזה | חסון וגבוה
  • New Delhi
  • הודו
supplyautonomy.com/labhprojectspvt.in
Welcome to Labh Group! Labh Group of Companies is a fast growing, well- recognized and an ISO 9001:2008 certified, Indian business group of global repute having presence in more than 100 countries... קראו עוד »
  • שקית אורז | מכונה אריזה | חסון וגבוה
  • Ahmedabad
  • הודו
supplyautonomy.com/rubyenterprise.in
Jaw crusher, complete crushing plant screening plant
  • מכונות היטב קידוח | מכונה כרייה המשמש | מכונה אריזה
  • Hooghly
  • הודו
supplyautonomy.com/brintexsalescorporation.in
Unicon Exports and Imports, is an acknowledged manufacturer and supplier of Pharmaceutical machines for different pharmaceutical sections viz. Granulation section, Liquid Section, Ointment Section... קראו עוד »
  • עיבוד זכוכית מכונות | הקפסולה מילוי המכונה | מכונה אריזה | כלי מעבדה וציוד...
  • New Delhi
  • הודו
supplyautonomy.com/relianceenterprise.in
Offering a wide range of Food Processing & Bakery Equipments such as Tomato Ketchup machine, Single Door Deck Oven, Planetary mixer, Spiral mixer, Rotary rack Oven, Tray Dryer, Vacuum Bottle... קראו עוד »
  • מפעל תעשיית מזון וציוד נס | מכונה לטחינת מתכת | מכונה אריזה | כלי מעבדה וציוד...
  • Kolkata
  • הודו
supplyautonomy.com/qingdaothinrawoodworkingmachineryfactory.cn
Our company is a professional company which is engaged in designing, manufacturing and selling woodworking machines. Since our establishment in 2009, we have got rapid development and a good... קראו עוד »
  • מכונות ייצור עור | חיתוך - מכונה כלים | מכונה אריזה | ציוד לעיבוד עץ
  • Qingdao
  • סין
supplyautonomy.com/problend.bg
We offer : -constructing, manufacture, service and innovative production solutions for packaging equipment -constructing, manufacture, service and innovation of non-standard equipment on... קראו עוד »
  • מניית רכיבים מכאנית כללית | אריזה ואריזה - מכונות וציוד
  • Shumen
  • בולגריה
supplyautonomy.com/hondonpackagingfoodmachinerygroup.cn
Paying attention to details, professional service, distinguished quality products and going the extra mile for our customers are the hallmark of Hondon. Supported by own manufacturing plants and... קראו עוד »
  • אריזה ואריזה - מכונות וציוד | מכונה אריזה
  • Tianjin
  • סין
supplyautonomy.com/sarongspa.it
SARONG is a private company situated in Reggiolo (RE), in the north of Italy. Founded in 1972 when it brought onto the market the first automatic packaging machine for pharmaceutical suppositories... קראו עוד »
  • אריזה ואריזה - מכונות וציוד | מכונה אריזה
  • Reggiolo
  • איטליה
supplyautonomy.com/dolzanimpiantisrl.it
Vertical packing machines, by weight / volume, with 4 welds, Doypack, vacuum, multi-track and semi-automatic for the food processing, pastry making, chemicals, pharmaceuticals and mechanical sectors.
  • אריזה ואריזה - מכונות וציוד | תעשיית מזון - מכונות וציוד
  • Galliera Veneta
  • איטליה
supplyautonomy.com/kansanmachineryco.tr
Kansan Machinery Company -today one of the major wet wipes, tissue napkins, toilet papers/towels machines and complete converting lines manufacturers- was established in 1992 as a small workshop. In... קראו עוד »
  • כמוסות מכסת וovercapping, פלסטיק | מכונה אריזה | מוצרי היגיינה ושירותים
  • İzmir
  • טורקיה
supplyautonomy.com/sicogaz.fr
  • עומדת תערוכה (השכרת / השכרה) | תערוכת אולמות (השכרת / השכרה) | חדרי ישיבות (השכרת / השכרה) | מארגני יריד סחר, הלבשה, הנע...
  • Puteaux
  • צרפת