Результаты поиска для: Упаковочные машины

Найдены 7631 компании

Связанные категории


supplyautonomy.com/pentagonmarketing.in
Available in various dimensions, specifications, capacities, efficiency, etc, packaging machinery find applications in various industries like chemical, marine, food, etc. Pentagon Marketing is... Подробнее »
  • Принтеры компьютерные для печати фотографий | Маркеры | Клеи и ленты | Упаковочное оборудование...
  • Kochi
  • Индия
supplyautonomy.com/taisunmachinery.tw
Tai sun machinery Co., ltd has been concentrating on the manufacture of the tissue paper converting machine since 1970. Now the "tai sun" brand has successfully exported A big quantity of... Подробнее »
  • машина изготовления полотенца | Упаковочное оборудование
  • Taipei
  • Тайвань
supplyautonomy.com/iterrainintlenterprisesco.tw
In the manufacture of those machines we use the most advanced modern techniques. We take pride in having offered the overseas markets products of unsurpassed quality and appearance for the 27 years.... Подробнее »
  • Кофейные зерна Java | другие использованные механизмы | Упаковочное оборудование...
  • Taichung
  • Тайвань
supplyautonomy.com/masaelimachinemanufacturing.ir
Masaeli Industry Machinery is a leading company is Iran`s packing industry founded in 1983.Our main products include pillow packing machines that are suitable for packing all of things in different... Подробнее »
  • Упаковочное оборудование | Упаковочные производственные линии
  • Esfahan
  • Иран
supplyautonomy.com/ptsancoindonesia.id
Sanco international based in Jakarta, Indonesia is a marketing arms company that owns an exclusive right to promote and to distribute end products from manufacturer of confectionery products in... Подробнее »
  • машина заполненной капусулы | Упаковочное оборудование
  • Jakarta
  • Индонезия
supplyautonomy.com/baodingjialifoodmachine.cn
Established in 1998, Baoding Jiali Food Machine Co.,ltd is a professional manufacturer engaged in research, development, production, sale and service of all kinds of food machines. Excellent... Подробнее »
  • Установки и оборудование для пищевой промышленности не указанные в другом месте | Упаковочное оборудование...
  • Baoding
  • Китай
supplyautonomy.com/zhejiangruianyongxinmachineryfactory.cn
Ruian Yongxin Machinery Factory is located in Ruian, Zhejiang province, the famous City of Packaging Machinery in China. It always devotes itself to researching and developing packaging or... Подробнее »
  • другие машины изготовления лекарства | Упаковочное оборудование...
  • Ruian
  • Китай
supplyautonomy.com/zhangjiagangkingstepmachineryco.cn
Our quality products are: Pure/Mineral water production lines Carbonated drink production lines; Fruit juice production lines Tea drink production lines Soy milk and protein drink production... Подробнее »
  • Чисто вода | Упаковочное оборудование
  • Suzhou
  • Китай
supplyautonomy.com/nissionfoodmachinerycorporation.cn
Qingdao Nissin Food Machinery Co., Ltd. is a Sino-Japanese joint venture established in 1989. Our company applies complete Japanese technology, blueprints and components and works together with... Подробнее »
  • машина изготовления легкой закуски | Упаковочное оборудование
  • Qingdao
  • Китай
supplyautonomy.com/hbfpt.cn
Our company originates at the beginning of the 1990. Our predecessor is the Shijjiazhuang Changan Stainless Steel Plant, with the registered capital of 1,800,000 and a staff of 70 people. Our... Подробнее »
  • Установки и оборудование для пищевой промышленности не указанные в другом месте | Лифт | Упаковочное оборудование | Скоб...
  • Shijiazhuang
  • Китай
supplyautonomy.com/guangzhouhaochiwoodworkingmachineryco.cn
Guangzhou JianChi Woodworking Machinery Co., Ltd. locates in ShaWan Town, Panyu Area, Guangzhou City. We have been insisting on the aim of "survive with quality and develop with... Подробнее »
  • Упаковочное оборудование | Деревообрабатывающее оборудование
  • Guangzhou
  • Китай
supplyautonomy.com/greatelectricsmachineco.cn
Since our establishment in 1989, Great-Electrics Machine Co., Ltd. has been the leading manufacturer in the thermoforming machine industry in China. We have a strong research and development team to... Подробнее »
  • Сварка | Пластиковые сварочные горелки | Упаковочное оборудование | подносы яйца...
  • Guangzhou
  • Китай
supplyautonomy.com/jayengineeringcombine.in
Standard spares and machineries for soap, detergent, chemicals HVAC Plants JAY ENGINEERING... Подробнее »
  • Упаковочное оборудование
  • Ahmedabad
  • Индия
supplyautonomy.com/bossengineeringcompany.in
Backed by industry experience of about a decade, we are engaged in manufacturing a completely automatic range of machines used in filling, capping, and labeling of bottles and containers. Our range... Подробнее »
  • Упаковочное оборудование | маишна упаковки лекарства | Другие упаковочные материалы...
  • Ahmedabad
  • Индия
supplyautonomy.com/shreejipharmatech.in
About Us Shreeji Pharmatech is one of the pioneering manufacturers of a wide range of Pharmaceutical Machineries like Dry Injectable Powder Filling Machine, Semi-automatic Dry Injectable Powder... Подробнее »
  • Другие Текстильное оборудование | Упаковочное оборудование
  • Ahmedabad
  • Индия
supplyautonomy.com/masterfil.gb
The Adelphi Group of Companies has served customers all over the world for over 60 years. Our products range form simple stainless steel vessels to complete turnkey filling and capping lines, all... Подробнее »
  • Упаковка и упаковочные материалы - техника и оборудование | Барабаны, ведра и баки...
  • Aylesbury
  • Великобритания
supplyautonomy.com/susmatexmachinery.in
Dear Visitors and customers, First of all, we would like to tell thanks to visitors and customers who visiting our website, so we are greatly pleased to introduce our company and our products to... Подробнее »
  • Машины для шнурков | Упаковочное оборудование
  • Ahmedabad
  • Индия
supplyautonomy.com/omchamundaenterprises.in
A om chamunda enterprisesis one of the leading manufacturer, exporter and supplier of packaging machine from India. Designed for efficient operation to meet the varying requirements of different... Подробнее »
  • машина заполненной капусулы | Упаковочное оборудование
  • Mumbai
  • Индия
supplyautonomy.com/shrivinayakpackagingmachinepvt.in
Incorporated in the year 2000, Shri Vinayak Print-Pack is a leading importer and supplier of packaging machines. The range includes semi / fully automatic packaging machines, strapping machines,... Подробнее »
  • Упаковочное оборудование | Ремень
  • New Delhi
  • Индия
supplyautonomy.com/labhprojectspvt.in
Welcome to Labh Group! Labh Group of Companies is a fast growing, well- recognized and an ISO 9001:2008 certified, Indian business group of global repute having presence in more than 100 countries... Подробнее »
  • Мешок для риса | Упаковочное оборудование | Ремень
  • Ahmedabad
  • Индия
supplyautonomy.com/rubyenterprise.in
Jaw crusher, complete crushing plant screening plant
  • Бурение скважин | Подержанные горнодобывающие механизмы | Упаковочное оборудование...
  • Hooghly
  • Индия
supplyautonomy.com/brintexsalescorporation.in
Unicon Exports and Imports, is an acknowledged manufacturer and supplier of Pharmaceutical machines for different pharmaceutical sections viz. Granulation section, Liquid Section, Ointment Section... Подробнее »
  • машина обработки стекла | машина заполненной капусулы | Упаковочное оборудование | Лабораторная посуда и оборудование...
  • New Delhi
  • Индия
supplyautonomy.com/relianceenterprise.in
Offering a wide range of Food Processing & Bakery Equipments such as Tomato Ketchup machine, Single Door Deck Oven, Planetary mixer, Spiral mixer, Rotary rack Oven, Tray Dryer, Vacuum Bottle... Подробнее »
  • Установки и оборудование для пищевой промышленности не указанные в другом месте | Станки для фрезерования металла | Упак...
  • Kolkata
  • Индия
supplyautonomy.com/qingdaothinrawoodworkingmachineryfactory.cn
Our company is a professional company which is engaged in designing, manufacturing and selling woodworking machines. Since our establishment in 2009, we have got rapid development and a good... Подробнее »
  • машина кажных продуктов | Станки для резки металла | Упаковочное оборудование | Деревообрабатывающее оборудование...
  • Qingdao
  • Китай
supplyautonomy.com/problend.bg
We offer : -constructing, manufacture, service and innovative production solutions for packaging equipment -constructing, manufacture, service and innovation of non-standard equipment on... Подробнее »
  • запасы общепринятых элементы механизма | Упаковка и упаковочные материалы - техника и оборудование...
  • Shumen
  • Болгария
supplyautonomy.com/hondonpackagingfoodmachinerygroup.cn
Paying attention to details, professional service, distinguished quality products and going the extra mile for our customers are the hallmark of Hondon. Supported by own manufacturing plants and... Подробнее »
  • Упаковка и упаковочные материалы - техника и оборудование | Упаковочное оборудование...
  • Tianjin
  • Китай
supplyautonomy.com/sarongspa.it
SARONG is a private company situated in Reggiolo (RE), in the north of Italy. Founded in 1972 when it brought onto the market the first automatic packaging machine for pharmaceutical suppositories... Подробнее »
  • Упаковка и упаковочные материалы - техника и оборудование | Упаковочное оборудование...
  • Reggiolo
  • Италия
supplyautonomy.com/dolzanimpiantisrl.it
Vertical packing machines, by weight / volume, with 4 welds, Doypack, vacuum, multi-track and semi-automatic for the food processing, pastry making, chemicals, pharmaceuticals and mechanical sectors.
  • Упаковка и упаковочные материалы - техника и оборудование | Пищевая промышленность - техника и оборудование...
  • Galliera Veneta
  • Италия
supplyautonomy.com/kansanmachineryco.tr
Kansan Machinery Company -today one of the major wet wipes, tissue napkins, toilet papers/towels machines and complete converting lines manufacturers- was established in 1992 as a small workshop. In... Подробнее »
  • Колпачки из пластика для двойной укупорки | Упаковочное оборудование | Туалетные и гигиенические принадлежности...
  • İzmir
  • Турция
supplyautonomy.com/sicogaz.fr
  • Услуги проката и аренды выставочных, демонстрационных стендов | Услуги проката и аренды выставочных, демонстрационных за...
  • Puteaux
  • Франция