Loading...
জন্য অনুসন্ধান ফলাফল: রাসায়নিক এবং ফার্মাসিউটিকাল সেবা
পাওয়া 549 কোম্পানিsupplyautonomy.com/hrsprocesssystems.in
Manufacturers, Exporters & Importers Of Wide Range Of Heat Exchangers, ECOFLUX* Corrugated Tube Heat Exchanger, Shell And Tube Heat Exchanger, UNICUS® Scraped Surface Heat Exchanger, ... আরো পড়ুন »
- উত্পাদন পরিষেবা, খাদ্যতালিকাগত কাজী নজরুল ইসলাম | ওষুধের মিশ্রণ | ওষুধের শোষক স্প্রে | প্রোটিন পরিশোধন সেবা | মানুষের হ...
- Pune
- ভারত
supplyautonomy.com/johnsonmattheyfuelcellslimited.gb
Export Johnson Matthey is a speciality chemicals company focussed on its core skills in precious metals, catalysts and fine chemicals. It is organised into three global divisions: Environmental... আরো পড়ুন »
- অনুঘটক এর পুনর্জন্ম | সক্রিয় কার্বন জন্য পুনর্জন্ম সেবা | ফোটোগ্রাফিক রাসায়নিক রিকভারি এবং পুনর্জন্ম | পুনরুদ্ধারের এব...
- London
- যুক্তরাজ্য
supplyautonomy.com/robinsonwirecloth.gb
Robinson Wire Cloth Ltd are a supplier of all types of filter meshes and materials. Our extensive in-house facilities enable us to manufacture woven mesh screens, tension screens and bonded screens... আরো পড়ুন »
- রাসায়নিক শিল্পের জন্য তরল Sieving | রাসায়নিক শিল্পের জন্য কঠিন বস্তুর এর Sieving | রাসায়নিক শিল্পের জন্য pastes এর Si...
- Stoke On Trent
- যুক্তরাজ্য
supplyautonomy.com/upgreensas.fr
supplyautonomy.com/sweco.us
- রাসায়নিক শিল্পের জন্য কঠিন বস্তুর এর Sieving | Humidifiers, খাবার, ভোজ্য উদ্ভিজ্জ তেল প্রক্রিয়াজাতকরণ | উনান, ভোজ্য oi...
- Florence
- মার্কিন যুক্তরাষ্ট্র
supplyautonomy.com/worldwaybiotech.cn
World-Way is specialized in marketing plant-derived extracts and fine chemicals for the nutraceutical, food and cosmetic industries for 15 years. World-Way is founded by Dr. Ginkgo Zeng, Professor in... আরো পড়ুন »
- ক্লাসিফিকেশন পরিষেবা, সূক্ষ্ম রাসায়নিক | ফাইন কেমিক্যালের | অন্য সূক্ষ্ম রাসায়নিক | চায়ের...
- Changsha
- চীন
supplyautonomy.com/kellyservices.fr
- আবহাওয়া পরামর্শদাতা | বাষ্প শক্তি পরামর্শদাতা | ভূপদার্থবিদ্যা পরামর্শদাতা | Hydrogeology পরামর্শদাতা | জমির উন্নয়ন পর...
- Clichy
- ফ্রান্স
supplyautonomy.com/sofresidengineering.fr
- Pipework ঠিকাদার, রাসায়নিক এবং পারমাণবিক effluent সিস্টেম | Pipework ইনস্টলেশন ঠিকাদার, রাসায়নিক উদ্ভিদ | Pipework ইনস...
- Montigny-le-Bretonneux
- ফ্রান্স
supplyautonomy.com/univar.fr
- রাসায়নিক যদি ইঙ্গিত - ইম্পোর্ট-এক্সপোর্ট | প্রোটিন পরিশোধন সেবা | রাসায়নিক শিল্পের জন্য pastes এর Sieving | রাসায়নিক ...
- Fontenay-sous-Bois
- ফ্রান্স
supplyautonomy.com/mediwelllaboratories.in
We are An ISO 9001:2015 , certified and is listed on all Drug updates. Our sister concern are Mediwell wellness , mediwell wellness & Phytomolecules Marcwell Laboratories , All of our... আরো পড়ুন »
- প্রসাধনী প্রক্রিয়াজাতকরণ | ভেষজ ওষুধ | ভেষজ ওষুধ | ব্যক্তিগত যত্ন পণ্য | পুরুষদের যত্ন | প্রসাধনী...
- Ambala City
- ভারত
supplyautonomy.com/shandongrunkechemicalco.cn
Shandong Runke Chemical Co., Ltd. was established in 2006 and finished holding and restructuring of Weifang Dacheng Salinization Co., Ltd. to the company in 2010. With a registered capital of 40... আরো পড়ুন »
- অন্যান্য রাসায়নিক পণ্য তৈয়ার n.e.c. | রাসায়নিক পণ্য | , ব্রোমাইন কঠিন, তরল বা বায়বীয়...
- Weifang
- চীন
supplyautonomy.com/gujaratfluorochemicalslimited.in
Gujarat Fluorochemicals Limited (GFL) is an Indian Chemicals Company with over 30 years of expertise in Fluorine Chemistry. GFL holds domain expertise in Fluoropolymers, Fluorospecialities,... আরো পড়ুন »
- রাসায়নিক উত্পাদনের | রাসায়নিক পদার্থসমূহ
- Noida
- ভারত
supplyautonomy.com/embelezarkosmetikinstitut.ca
So wie ich mir für meine Haut nur das Beste gönne, lege ich auch in meinem Kosmetikstudio in Frankfurt größten Wert auf die Qualität meiner kosmetischen Produkte und Behandlungen. Als langjährig erfah... আরো পড়ুন »
- অঙ্গরাগ চিকিত্সা সেবা | প্রসাধনী প্রক্রিয়াজাতকরণ...
- Frankfurt am Main
- জার্মানি
supplyautonomy.com/shandongsunshinechemicaltechnologyco.cn
Shandong Sunshine Chemical Technology Co., Ltd. specializes in R&D, production and management of disinfectant, additives and polymer, and its factory was built in accordance with GMP standards.... আরো পড়ুন »
- অন্যান্য রাসায়নিক পণ্য তৈয়ার n.e.c. | সুইমিং পুলের জন্য ক্লোরিন জেনারেটর | রাসায়নিক পণ্য | রাসায়নিক ও রাসায়নিক পণ্য...
- Yanggu
- চীন
supplyautonomy.com/northeastagrochem.cn
Agrochemicals products.
Main products: Malathion, Chlorpyrifos, Thiamethoxam, and others. (Technical and Formulation)
Aгрохимикатов продукции.
Основная продукция: Малатион, Хлорпирифос, Тиаметокса... আরো পড়ুন »
- কীটনাশক এবং অন্যান্য agrochemical পণ্য প্রস্তুতকারক | Agrochemicals | Agrochemical | অন্য agrochemicals এবং কীটনাশক | Ag...
- Jinxi
- চীন
supplyautonomy.com/chemiplastinternational.pk
Chemiplast International is a strong, family rooted company – founded by a cotton trading veteran Mr. Abid Ali (late) in 1999 with a vision to make Chemiplast one of the leading trading companies ... আরো পড়ুন »
- নমনীয় (pu) | পলিমার | দ্রাবক | অন্যান্য রাসায়নিক দ্রব্য উত্পাদন | রাসায়নিক ও রাসায়নিক পণ্য প্রস্তুতকারক...
- Karachi
- পাকিস্তান
supplyautonomy.com/texmor.mx
In 1981, the painting factory Permil S.A. of C.V. I think you will sit in the market of the surest. Our mission is to protect and decorate beautifully designed motifs for the three brothers, written... আরো পড়ুন »
- Dyes এবং pigments উত্পাদন | রঙে, varnishes এবং অনুরূপ COATINGS, ছাপার কালি এবং mastics উত্পাদন | রঙে এবং primers...
- Xochitepec
- মক্সিকো
supplyautonomy.com/varunpolymers.in
Varun Polymers is one of the leading manufacturer and exporter in India, of premium quality recycled rubber products. We manufacture rubber reclaiming agent such as:
1 Di Aryl Di Sulphide
2 ... আরো পড়ুন »
- কাস্টম রাসায়নিক সেবা | বল ভালভ | প্লাস্টিক পণ্য | ADHESIVES এবং টেপ | Moulded উপাদান, কোয়ার্টজ নিলীন...
- Ahmedabad
- ভারত
supplyautonomy.com/lgobbisrl.it
- উত্পাদন পরিষেবা, খাদ্যতালিকাগত কাজী নজরুল ইসলাম | অনুঘটক এর পুনর্জন্ম | সক্রিয় কার্বন জন্য পুনর্জন্ম সেবা | ফোটোগ্রাফিক...
- CAMPO LIGURE (GE)
- ইতালী
supplyautonomy.com/todecasa.es
- ক্লাসিফিকেশন পরিষেবা, সূক্ষ্ম রাসায়নিক | রাসায়নিক পাতন | পানীয় শিল্পের জন্য খামির | চেঁচানো, bakers ' | মিষ্টান্ন চেঁ...
- Barcelona
- স্পেন
supplyautonomy.com/eastmanchemicalcompany.us
- কাস্টম রাসায়নিক সেবা | সোডিয়াম, তরল | সোডিয়াম metabisulphite / সোডিয়াম pyrosulphite | সোডিয়াম methoxide / সোডিয়াম ...
- Kingsport
- মার্কিন যুক্তরাষ্ট্র
supplyautonomy.com/pelletspharmalimited.in
Manufacturers & Exporters of Sustained / Modified Release Pellets / Micro Granules - Retardstomized Development And Manufacturing Of SR Pellets/Micro Granules-Retard of Various Active... আরো পড়ুন »
- ওষুধের মিশ্রণ | স্নায়ুতন্ত্রের রোগ, সিডেটিভস্, tranquillizers, চীনা ঔষধ জন্য প্রস্তুতি | Endocrine রোগ, চীনা মেডিসিন জন...
- Hyderabad
- ভারত
supplyautonomy.com/islandwidemarketingservicespvt.lk
Import & Supply of Industrial Chemicals,Machinery Lab Equipment,Packaging along with the Technological Inputs & Clearing & Forwarding Agents,Export of Coconut based... আরো পড়ুন »
- পুনরুদ্ধারের এবং উদ্বায়ী জৈব যৌগের পুনর্জন্ম (VOC) | প্রোটিন পরিশোধন সেবা | রাসায়নিক শিল্পের জন্য তরল Sieving | রাসায়...
- Rajagiriya
- শ্রীলঙ্কা
supplyautonomy.com/developpementbernardplasencia.fr
- ফার্মাসিউটিক্যাল উৎপাদন প্রকৌশল পরামর্শদাতা | বায়োকেমিক্যাল ইঞ্জিনিয়ারিং পরামর্শদাতা | সক্রিয় কার্বন জন্য পুনর্জন্ম স...
- Saint-Priest
- ফ্রান্স
supplyautonomy.com/aircontrolsa.es
- কুলিং উদ্ভিদ, কারাপরিদর্শক প্রকল্প | উত্পাদন পরিষেবা, খাদ্যতালিকাগত কাজী নজরুল ইসলাম | ওষুধের মিশ্রণ | ওষুধের শোষক স্প্...
- San Sebastián
- স্পেন
supplyautonomy.com/borgessa.es
- Grouting, প্লাস্টার ভিত্তি করে | উত্পাদন পরিষেবা, খাদ্যতালিকাগত কাজী নজরুল ইসলাম | পণ্য সোমালিয়ার, কাঁচা রাবার এবং ক্ষী...
- Reus
- স্পেন
supplyautonomy.com/crealis.fr
- ম্যানেজমেন্ট পরামর্শ | রাসায়নিক পাতন | বৈদ্যুতিক এবং ইলেকট্রনিক ইনস্টলেশনের জন্য, পণ্য, রাসায়নিক পরিষ্কারের | তথ্য প্র...
- Bry
- ফ্রান্স
supplyautonomy.com/epiingredients.fr
- ওষুধের মিশ্রণ | রাসায়নিক শিল্পের রঙে এবং pigments এর মিশ্রণ | আদা তেল | চূর্ণ এবং সংক্ষিপ্ত দুধ | পানীয় শিল্পের জন্য খ...
- Ancenis
- ফ্রান্স
supplyautonomy.com/ktronfrance.fr
- উত্পাদন পরিষেবা, খাদ্যতালিকাগত কাজী নজরুল ইসলাম | পরিষেবা, দ্রাবক এবং ADHESIVES, শিল্প ভর্তি এবং প্যাকেজিং | ওষুধের মিশ্...
- Croissy-sur-Celle
- ফ্রান্স
supplyautonomy.com/hosokawamicronlimited.gb
Hosokawa Micron Ltd is your single source for integrated powder processing systems and containment solutions. Our core products and services include particle design for nano technology, size... আরো পড়ুন »
- প্রযুক্তি প্রকৌশল পরামর্শদাতা মেশানো এবং মিশ্রণ | উত্পাদন পরিষেবা, খাদ্যতালিকাগত কাজী নজরুল ইসলাম | ওষুধের মিশ্রণ | ওষুধ...
- Runcorn
- যুক্তরাজ্য