Search Results for: Demagnetising products for iron and steel
Found 76 companiesPreferred listings related to: Demagnetising products for iron and steel
supplyautonomy.com/sofevalvalencay.fr
Construction of surface treatment material. Manufacturer of equipment to prepare surfaces, material for treating metals. Manufactuere of surface treatment tunnels, drying kilns, paint-spraying... Read More »
- Jet aircraft repair, overhaul and maintenance services | Propeller aircraft repair, overhaul and maintenance services |...
- Valençay
- France
supplyautonomy.com/dilers.lv
Company Dilers SIA is the Latvian manufacturer of aluminium alloys:
- casting alloys in ingots DIN 226, DIN 231, DIN 230, DIN 260 etc
- extrusion billets 60XX series, 178 mm, homogenised
-... Read More »
- Blending of paints and pigments for the chemical industry | Marking machines for roads, car parks and floors |...
- Riga
- Latvia
supplyautonomy.com/chemicalconvertorspty.za
Chemical Convertors is one of the leading chemical manufacturers in South Africa for the past 13 years. We manufacture a wide range of products for both international as well as nation wide markets.... Read More »
- Custom chemical services | Greases, silicon | Lubricants, polytetrafluoroethylene (PTFE) based | Descaling chemicals...
- Kempton Park
- South Africa
supplyautonomy.com/kursunelkalipmetalformvesacislsan.tr
URSUNEL MOULD , who has a right to getting KUKAMET trademark registration , starts to manufacture in square 25m2 by Hasan Kursunel ; therefore continues the fabrication about 2000m2 covered area... Read More »
- Hammers, pneumatic | Spray guns, pneumatic | Blow guns, pneumatic | Riveting guns, pneumatic | Sand-blasting guns,...
- Konya
- Turkey
supplyautonomy.com/mecshotblastingequipmentspvt.in
Manufacturers & Exporters of Air Operated Abrasive Blasting, Shot Peening Machines, Industrial Dust Collectors, Paint Booths used for Blast Cleaning & Finishing Applications.... Read More »
- Cleaning equipment | Anti-foaming agents for steam boilers | Electronic supplies | Finishing machines, automatic, for...
- Jodhpur
- India
supplyautonomy.com/crcilimousin.fr
- Information services, environmental issues | Meteorological services, online | Meteorological services | Chambers of...
- Feytiat
- France
supplyautonomy.com/svenskatansoab.se
Svenska Tanso AB
was established in 1981 and is active within the following product areas:
graphite and technical carbon for electrical, metallurgical, mechanical etc. applications
electrode... Read More »
- Anti-foaming agents for steam boilers | Insulating materials, bitumen and asphalt | Water infiltration proofing...
- Jönköping
- Sweden
supplyautonomy.com/ciefrdessilicesetsablesdenemours.fr
- Alums, natural | Raw materials for construction and public works | Quicklime/calcium oxide | Schist | Pipeclay | Clay,...
- Paris
- France
supplyautonomy.com/phylaxiapharmagyogyszeroltoanyagesagrobiologiaikeszitmenyeketgyarto.hu
- Crushing services for minerals and ores | Milling services for minerals and ores | Micronising services for minerals...
- Budapest
- Hungary
supplyautonomy.com/acopolit.fr
- Corrosion prevention and control consultants | Steels and metals - surface treatment and coating | Corrosion testing...
- Pessac
- France
supplyautonomy.com/arc.fr
- Public works contractors | Anti-foaming agents for steam boilers | Buildings, prefabricated | Deodorants for plastics |...
- Le Bourget
- France
supplyautonomy.com/ehworleecogmbhcokg.de
- Grouting, plaster based | Food - import-export | Commodity merchants, raw rubber and latex | Commodity merchants, crude...
- Hamburg
- Germany
supplyautonomy.com/kuhngmbh.de
- POS - stores and supermarkets | Point-of-sale advertising | Quicklime/calcium oxide | Lime, dolomitic, industrial |...
- Rauhenebrach
- Germany
supplyautonomy.com/sadesoldaduraymetalizacionatomizada.es
- Steels and metals - surface treatment and coating | Chlorine generators for swimming pools | Filter bags | Sherardising...
- Erandio
- Spain
supplyautonomy.com/todecasa.es
- Classification services, fine chemicals | Distillation of chemicals | Yeast for the beverage industry | Yeast, bakers'...
- Barcelona
- Spain
supplyautonomy.com/industriasllovesl.es
- Anti-foaming agents for steam boilers | Descaling chemicals for metals | Rust removers | Degreasing products for metals...
- Ripollet
- Spain
supplyautonomy.com/wheelabratorgroupslu.es
- Jet aircraft repair, overhaul and maintenance services | Propeller aircraft repair, overhaul and maintenance services |...
- Barcelona
- Spain
supplyautonomy.com/adiegohermanossa.es
- Cutting pastes for stainless steel, synthetic lubricant based | Refrigerants | Anti-foaming agents for steam boilers |...
- Cuarte de Huerva
- Spain
supplyautonomy.com/epiingredients.fr
- Blending of pharmaceuticals | Blending of paints and pigments for the chemical industry | Ginger oil | Powdered and...
- Ancenis
- France
supplyautonomy.com/sudarshandhoopp.in
Manufacturers and Exporters of Incense Products like Dhoop, Agarbathi Coils and Cones, Extruded Bambooless Sticks, Incense Sticks, Magical Charcoal Tablets, Pure Natural Agarbatti, Incense Gift Sets... Read More »
- Production services, dietary supplements | Filling and packaging services, solvents and adhesives, industrial |...
- New Delhi
- India
supplyautonomy.com/azelisfrance.fr
- Production services, dietary supplements | Chemicals - import-export | Blending of pharmaceuticals | Spray drying of...
- Paris
- France
supplyautonomy.com/islandwidemarketingservicespvt.lk
Import & Supply of Industrial Chemicals,Machinery Lab Equipment,Packaging along with the Technological Inputs & Clearing & Forwarding Agents,Export of Coconut based... Read More »
- Recovery and regeneration of volatile organic compounds (VOC) | Protein purification services | Sieving of liquids for...
- Rajagiriya
- Sri Lanka
supplyautonomy.com/developpementbernardplasencia.fr
- Pharmaceutical production engineering consultants | Biochemical engineering consultants | Regeneration services for...
- Saint-Priest
- France
supplyautonomy.com/termetalandrzejzborowski.pl
- Springs, piston ring | Springs, heald | Springs, valve, engine | Springs, relief valve | Springs, aerosol valve |...
- Piekary
- Poland
supplyautonomy.com/goviproductioncompany.be
- Lubricants, graphite | Metal tempering products | Post-etch residue removers | Brass plating chemicals | Lead coating...
- Ghent
- Belgium
supplyautonomy.com/bropolhtpspzoo.pl
- Metallurgy - machinery and installations | Descaling chemicals for metals | Rust removers | Degreasing products for...
- Katowice
- Poland
supplyautonomy.com/kdfeddersencoueberseegesellschaftmbh.de
- Grouting, plaster based | Nuts and bolts | Hardware, building construction | Scagliola | Gypsum, calcined | Gypsum for...
- Hamburg
- Germany
supplyautonomy.com/borgessa.es
- Grouting, plaster based | Production services, dietary supplements | Commodity merchants, raw rubber and latex |...
- Reus
- Spain
supplyautonomy.com/peviengineeringenterprises.in
Manufacturers And Exporters Of Mosquito Coil Making Machinery Like Pulveriser, Kneading Machinery, Sieving Machinery, Crusher, Blender, Extruder, Driers, Ovens, Stamping Machinery, Compressor, Trays,... Read More »
- Food thawing machines | Smoke generators, food flavouring | Degreasing machinery, food industry | Washing machinery,...
- Hyderabad
- India
supplyautonomy.com/southeasttradingoy.fi
- Aerosol container filling services | Pressurised container filling services | Petroleum refineries | Anti-foaming...
- LAPPEENRANTA
- Finland