Search Results for: Demagnetising products for iron and steel

Found 76 companies


supplyautonomy.com/chemicalconvertorspty.za
Chemical Convertors is one of the leading chemical manufacturers in South Africa for the past 13 years. We manufacture a wide range of products for both international as well as nation wide markets.... Read More »
  • Custom chemical services | Greases, silicon | Lubricants, polytetrafluoroethylene (PTFE) based | Descaling chemicals...
  • Kempton Park
  • South Africa
supplyautonomy.com/kursunelkalipmetalformvesacislsan.tr
URSUNEL MOULD , who has a right to getting KUKAMET trademark registration , starts to manufacture in square 25m2 by Hasan Kursunel ; therefore continues the fabrication about 2000m2 covered area... Read More »
  • Hammers, pneumatic | Spray guns, pneumatic | Blow guns, pneumatic | Riveting guns, pneumatic | Sand-blasting guns,...
  • Konya
  • Turkey
supplyautonomy.com/mecshotblastingequipmentspvt.in
Manufacturers & Exporters of Air Operated Abrasive Blasting, Shot Peening Machines, Industrial Dust Collectors, Paint Booths used for Blast Cleaning & Finishing Applications.... Read More »
  • Cleaning equipment | Anti-foaming agents for steam boilers | Electronic supplies | Finishing machines, automatic, for...
  • Jodhpur
  • India
supplyautonomy.com/crcilimousin.fr
  • Information services, environmental issues | Meteorological services, online | Meteorological services | Chambers of...
  • Feytiat
  • France
supplyautonomy.com/svenskatansoab.se
Svenska Tanso AB was established in 1981 and is active within the following product areas: graphite and technical carbon for electrical, metallurgical, mechanical etc. applications electrode... Read More »
  • Anti-foaming agents for steam boilers | Insulating materials, bitumen and asphalt | Water infiltration proofing...
  • Jönköping
  • Sweden
supplyautonomy.com/ciefrdessilicesetsablesdenemours.fr
  • Alums, natural | Raw materials for construction and public works | Quicklime/calcium oxide | Schist | Pipeclay | Clay,...
  • Paris
  • France
supplyautonomy.com/phylaxiapharmagyogyszeroltoanyagesagrobiologiaikeszitmenyeketgyarto.hu
  • Crushing services for minerals and ores | Milling services for minerals and ores | Micronising services for minerals...
  • Budapest
  • Hungary
supplyautonomy.com/acopolit.fr
  • Corrosion prevention and control consultants | Steels and metals - surface treatment and coating | Corrosion testing...
  • Pessac
  • France
supplyautonomy.com/arc.fr
  • Public works contractors | Anti-foaming agents for steam boilers | Buildings, prefabricated | Deodorants for plastics |...
  • Le Bourget
  • France
supplyautonomy.com/ehworleecogmbhcokg.de
  • Grouting, plaster based | Food - import-export | Commodity merchants, raw rubber and latex | Commodity merchants, crude...
  • Hamburg
  • Germany
supplyautonomy.com/kuhngmbh.de
  • POS - stores and supermarkets | Point-of-sale advertising | Quicklime/calcium oxide | Lime, dolomitic, industrial |...
  • Rauhenebrach
  • Germany
supplyautonomy.com/sadesoldaduraymetalizacionatomizada.es
  • Steels and metals - surface treatment and coating | Chlorine generators for swimming pools | Filter bags | Sherardising...
  • Erandio
  • Spain
supplyautonomy.com/todecasa.es
  • Classification services, fine chemicals | Distillation of chemicals | Yeast for the beverage industry | Yeast, bakers'...
  • Barcelona
  • Spain
supplyautonomy.com/industriasllovesl.es
  • Anti-foaming agents for steam boilers | Descaling chemicals for metals | Rust removers | Degreasing products for metals...
  • Ripollet
  • Spain
supplyautonomy.com/wheelabratorgroupslu.es
  • Jet aircraft repair, overhaul and maintenance services | Propeller aircraft repair, overhaul and maintenance services |...
  • Barcelona
  • Spain
supplyautonomy.com/adiegohermanossa.es
  • Cutting pastes for stainless steel, synthetic lubricant based | Refrigerants | Anti-foaming agents for steam boilers |...
  • Cuarte de Huerva
  • Spain
supplyautonomy.com/epiingredients.fr
  • Blending of pharmaceuticals | Blending of paints and pigments for the chemical industry | Ginger oil | Powdered and...
  • Ancenis
  • France
supplyautonomy.com/sudarshandhoopp.in
Manufacturers and Exporters of Incense Products like Dhoop, Agarbathi Coils and Cones, Extruded Bambooless Sticks, Incense Sticks, Magical Charcoal Tablets, Pure Natural Agarbatti, Incense Gift Sets... Read More »
  • Production services, dietary supplements | Filling and packaging services, solvents and adhesives, industrial |...
  • New Delhi
  • India
supplyautonomy.com/azelisfrance.fr
  • Production services, dietary supplements | Chemicals - import-export | Blending of pharmaceuticals | Spray drying of...
  • Paris
  • France
supplyautonomy.com/islandwidemarketingservicespvt.lk
Import & Supply of Industrial Chemicals,Machinery Lab Equipment,Packaging along with the Technological Inputs & Clearing & Forwarding Agents,Export of Coconut based... Read More »
  • Recovery and regeneration of volatile organic compounds (VOC) | Protein purification services | Sieving of liquids for...
  • Rajagiriya
  • Sri Lanka
supplyautonomy.com/developpementbernardplasencia.fr
  • Pharmaceutical production engineering consultants | Biochemical engineering consultants | Regeneration services for...
  • Saint-Priest
  • France
supplyautonomy.com/termetalandrzejzborowski.pl
  • Springs, piston ring | Springs, heald | Springs, valve, engine | Springs, relief valve | Springs, aerosol valve |...
  • Piekary
  • Poland
supplyautonomy.com/goviproductioncompany.be
  • Lubricants, graphite | Metal tempering products | Post-etch residue removers | Brass plating chemicals | Lead coating...
  • Ghent
  • Belgium
supplyautonomy.com/bropolhtpspzoo.pl
  • Metallurgy - machinery and installations | Descaling chemicals for metals | Rust removers | Degreasing products for...
  • Katowice
  • Poland
supplyautonomy.com/kdfeddersencoueberseegesellschaftmbh.de
  • Grouting, plaster based | Nuts and bolts | Hardware, building construction | Scagliola | Gypsum, calcined | Gypsum for...
  • Hamburg
  • Germany
supplyautonomy.com/borgessa.es
  • Grouting, plaster based | Production services, dietary supplements | Commodity merchants, raw rubber and latex |...
  • Reus
  • Spain
supplyautonomy.com/peviengineeringenterprises.in
Manufacturers And Exporters Of Mosquito Coil Making Machinery Like Pulveriser, Kneading Machinery, Sieving Machinery, Crusher, Blender, Extruder, Driers, Ovens, Stamping Machinery, Compressor, Trays,... Read More »
  • Food thawing machines | Smoke generators, food flavouring | Degreasing machinery, food industry | Washing machinery,...
  • Hyderabad
  • India
supplyautonomy.com/southeasttradingoy.fi
  • Aerosol container filling services | Pressurised container filling services | Petroleum refineries | Anti-foaming...
  • LAPPEENRANTA
  • Finland