Резултати претраге: Штампање графика и опрема
Фоунд 277 компанијеПреферред огласи везани за: Штампање графика и опрема
supplyautonomy.com/seniorprintpackmachineryco.in
Manufacturers & Exporters Of Corrugated Board, Box Making Machinery, Corrugated Board Making Plant, Die Punching, Cutting, Creasing & Embossing Machine, Hot Foil Stamping Die Cutting... Прочитајте више »
- Торба Машине | Штампање графика и опрема | Машине и опрема за сортирање папира | Излагалне уређаји (фасцикле), чине карт...
- Hyderabad
- Индија
supplyautonomy.com/cooltechenterprises.in
A renowned name in the domain of Cooling Pads, ABS Ductable Cooling Machine, Desert/Room Coolers, etc., Cool Tech Enterprises has been offering quality to the clients. Combining technology and wide... Прочитајте више »
- Безбедност производа агенти | Трансфер штампу | БРИЗГАЊЕ, метални | Изолациони материјали | Цустом дизајн опруге | Спојн...
- Amravati
- Индија
supplyautonomy.com/chamundaindustries.in
We are pleased to introduce ourselves as one of the leading Exporters, Manufacturers , Stockists Supplier of stainless steel item,ferrous non-ferrous metal which are required by your company in... Прочитајте више »
- Безбедност производа агенти | Трансфер штампу | БРИЗГАЊЕ, метални | Изолациони материјали | Цустом дизајн опруге | Спојн...
- Mumbai
- Индија
supplyautonomy.com/hardikenterprises.in
We, Hardik Enterprises, are a customer oriented company involved in the manufacturing & supplying of premium quality industrial fittings. We started our journey in the year 2012, with an... Прочитајте више »
- Безбедност производа агенти | Трансфер штампу | БРИЗГАЊЕ, метални | Изолациони материјали | Цустом дизајн опруге | Спојн...
- Faridabad
- Индија
supplyautonomy.com/acmemachinerycompany.in
ACME machinery company was established in 1961,
started catering mainly to varied Printing Press and later to Packaging Industry as well, around India. The company built its reputation through... Прочитајте више »
- Остале Одећа Машине | Штампање графика и опрема | Машине за производњу картона, бесконачно, цилиндрична | Пицкуп обрасци...
- Mumbai
- Индија
supplyautonomy.com/ashokenterprise.in
Ashok Enterprise is a reliable firm, known as a trustworthy Trader and Supplier of Garden & Farm Equipment, Engine & Pumpset, Pumps, Generators and Electrical & Control Panels. Our... Прочитајте више »
- Безбедност производа агенти | Трансфер штампу | БРИЗГАЊЕ, метални | Изолациони материјали | Цустом дизајн опруге | Спојн...
- Bardoli
- Индија
supplyautonomy.com/graphicarbproducts.in
Empowered by experienced professionals who possess sound knowledge of the latest technology, Graphicarb Products has been functioning since 1990. Our company is acknowledged as the leading... Прочитајте више »
- Безбедност производа агенти | Трансфер штампу | БРИЗГАЊЕ, метални | Изолациони материјали | Цустом дизајн опруге | Спојн...
- Ahmedabad
- Индија
supplyautonomy.com/jitamitraelectroenggpvt.in
An Overview Jitamitra Electro Engg Pvt. Ltd. is a part of ZEN Group, which was established in 1993. Operating from a state-of-the-art infrastructural setup at Ahmednagar (Maharashtra), the company is... Прочитајте више »
- Безбедност производа агенти | Трансфер штампу | БРИЗГАЊЕ, метални | Изолациони материјали | Цустом дизајн опруге | Спојн...
- Pune
- Индија
supplyautonomy.com/marutienterprise11.in
We, Maruti Enterprise, are working as a prominent Manufacturer and Supplier of Packaging Trays, Food Packaging Trays, Meal Packaging Trays, Blister Forming Packaging, Blister Packaging Tray, Cake... Прочитајте више »
- Безбедност производа агенти | Трансфер штампу | БРИЗГАЊЕ, метални | Изолациони материјали | Цустом дизајн опруге | Спојн...
- Kalol
- Индија
supplyautonomy.com/akshardhamindustries.in
Manufacturer and Exporters of Multi Colour Gravure Printing Press, Lamination and Slitting Machines.
- Штампање графика и опрема | Штампарија, цилиндрични, еновртљиви | Штампарија, цилиндрични, двовртљиве | Штампарија, цили...
- Wadhwan
- Индија
supplyautonomy.com/angelindiacadcampvt.in
Manufacturer, Exporters & Importers of Cutting Plotters, Laser Engravers, Laser Market, CNC Router, Fiber Laser, Laser Welder, Inkjet Printers, Solvent Printer and All kinds of Ink for... Прочитајте више »
- Торбе | Машине за мокро парење, текстил | Машине за суво парење, текстил | Машине за парење, низак притисак, текстил | С...
- New Delhi
- Индија
supplyautonomy.com/gurusalescorporation.in
With extensive industry experience and in-depth knowledge, we, Guru Sales Corporation have established ourselves among the leading suppliers and service providers of high quality Granite Tiles, Solar... Прочитајте више »
- Безбедност производа агенти | Трансфер штампу | БРИЗГАЊЕ, метални | Изолациони материјали | Цустом дизајн опруге | Спојн...
- Ilkal
- Индија
supplyautonomy.com/gehlotworks.in
Manufacturers and Exporters of Flexo Graphic and Roto-Gravure Printing Machines.
- Увозници / извозници, папир | Тоалет папир | Салвете, марамице и чишћење лица марамице, од целулозе | Тоалет папир, влаж...
- Jodhpur
- Индија
supplyautonomy.com/laxmiudyog.in
- Безбедност производа агенти | Трансфер штампу | БРИЗГАЊЕ, метални | Изолациони материјали | Цустом дизајн опруге | Спојн...
- Mumbai
- Индија
supplyautonomy.com/engineersudyog.in
With extensive technical expertise and a well maintained infrastructure, we, Modern Industries, have carved an eminent position in the competitive market. We are reckoned as a prominent manufacturer,... Прочитајте више »
- Спојнице | Лоптасте славине | Залистак | Транспортери, цемент, ојачан влакнима | Ватросталних производа, цемента, ојачан...
- Howrah
- Индија
supplyautonomy.com/lineomaticgraphicindustries.in
Welcome to the world of precision perfection. commitment assurance. innovation excellence. quality and originality.
Line O Matic Graphic Industries has always been a precursor in introducing... Прочитајте више »
- Штампање графика и опрема | Машине за обраду папира | Штампачи и везива...
- Ahmedabad
- Индија
supplyautonomy.com/wenzhouduke.cn
Wenzhou Duke Import Export Co., ltd is Located in the Ruian city .We specialized in supplying plastic production machine,auto parts,shopping bags and so on ,especially the brake pads and film... Прочитајте више »
- Стреч фолије | Штампање графика и опрема | Машине за паковање
- Wenzhou
- Кина
supplyautonomy.com/cangzhoutongbaocartonmachineryco.cn
Our corporation specializes in the development and production of cardboard machinery in Northern China. There are 280 employees in our corporation now and 68 staff members specialize in scientific... Прочитајте више »
- Штампање графика и опрема | Машине за обраду папира | Алатне машине за глодање метала...
- Cangzhou
- Кина
supplyautonomy.com/vicstarmachinerygroup.cn
Shenzhen Vicstar Imp. Exp. Co., Ltd. is specialized in manufacturing of packaging and printing machines, as one of the backbone enterprises in packaging and printing industries in China.
Our... Прочитајте више »
- Штампање графика и опрема | Ласерска опрема
- Shenzhen
- Кина
supplyautonomy.com/taixinglianbangprintingproductsco.cn
PS and CTP Plate is the most comprehensive applied offset plate in the printing industry,China has been developed into a world manufacture plant of offset plate.LianBang Printing Products Co.,Ltd... Прочитајте више »
- Чишћење опреме | Штампање графика и опрема
- Taixing
- Кина
supplyautonomy.com/ruianweiguoprintingpackagingmachineryfactory.cn
Wenzhou Qiangtuo Machinery Co., Ltd. (Ruian Weiguo Machinery Pakage Factory) is a professional manufacturer of printing machines, film-blowing machines, bag-making machines, slitting machines and... Прочитајте више »
- Штампање графика и опрема | Остала индустријска опрема
- Wenzhou
- Кина
supplyautonomy.com/ruianwanyuanpackingmachineco.cn
We are a manufacturer of non woven bag-making machines with well-equipped testing equipment and strong technical force. With a wide range, good quality, reasonable prices and stylish designs, our... Прочитајте више »
- Торба Машине | Штампање графика и опрема
- Ruian
- Кина
supplyautonomy.com/ruianlishengprintingpackagingmachineryco.cn
Ruian Lisheng Prining Packing Machinery Factory is an enterprise producing complete sets of plastic soft packing and paper packing equipment. Taking science and technology as support, customer... Прочитајте више »
- Торба Машине | Штампање графика и опрема
- Ruian
- Кина
supplyautonomy.com/ruianjiangnanmachineryco.cn
As high quality needs of lifr today,beautifully packaged required by everything.Ruian ZHEREN Printing Machine Co,.Ltd.were set up,located in the East China Sea,"Ruian City"
ZHEREN... Прочитајте више »
- Торба Машине | Штампање графика и опрема
- Ruian
- Кина
supplyautonomy.com/cheungwohingprintingmachineryco.cn
Established in 1995, Cheung Wo Hing Printing Machinery Co., Ltd. (CWH) is a large-scale company based on Hong Kong capital. We concentrate on the RD, manufacturing, and marketing of professional... Прочитајте више »
- Штампање графика и опрема | Папир за израду производа
- Dongguan
- Кина
supplyautonomy.com/wenzhouounuopackingmachineryco.cn
Wenzhou Ounuo Machinery Co., Ltd. is a professional manufacturer of fully automatic non-woven bag making machines, Paper cup machine,Non woven Screen printing Machine,Nonwoven printing machines,... Прочитајте више »
- Вреће и кесе | Машине за шивење | Штампање графика и опрема | Машине за паковање...
- Wenzhou
- Кина
supplyautonomy.com/ntexengineeringworkspvt.in
N-TEX Group focuses on productivity, providing flexible solutions wherever resources, performance and interaction requirements permit. By translating a deep understanding of our customers'... Прочитајте више »
- Остале текстилне машине | Штампање графика и опрема
- Ahmedabad
- Индија
supplyautonomy.com/xlplastics.in
We are pleased to Introduce ourselves and it would not be out of place to say that we are one of the leading manufacturers of Plastic Film converting machinery in the Asian Sub Continent. We have... Прочитајте више »
- Торба Машине | Штампање графика и опрема | Машине за паковање
- Vadodara
- Индија
supplyautonomy.com/krishnaengineeringworks6.in
We are pleased to introduce ourselves as one of the leading manufacturers of Plastic Packaging, Paper Converting, Textile Processing Tyre Cord machineries from India. Please visit us at WWW.... Прочитајте више »
- Машине за текстил | Штампање графика и опрема | Машине за паковање
- Ahmedabad
- Индија
supplyautonomy.com/jayomaindustries.in
JAYOMA INDUSTRIES is Manufacturers and Exporter of Textile Screen Both Of Rotary And Flat screen Machinery and Spares. And Also Manufacturing Flexo Plate making Equipments. JAYOMA is Established in... Прочитајте више »
- Штампање графика и опрема | Вреће цемента | Електрична и електронска опрема...
- Ahmedabad
- Индија