에 대한 검색 결과 : 인쇄 및 그래픽 장비
발견 277 회사관련된 기본 목록 : 인쇄 및 그래픽 장비
supplyautonomy.com/seniorprintpackmachineryco.in
Manufacturers & Exporters Of Corrugated Board, Box Making Machinery, Corrugated Board Making Plant, Die Punching, Cutting, Creasing & Embossing Machine, Hot Foil Stamping Die Cutting... 자세히보기 »
- 가방 기계 만들기 | 인쇄 및 그래픽 장비 | 용지 정렬 기계 및 장비 | 레이아웃 시스템 (layboys), 종이 변환 | 시트 계산 기계, 종이 변환 | 종이 시트 및 판 계산 및 탭을 삽입 기계 | 종이 묶음 ...
- Hyderabad
- 인도
supplyautonomy.com/cooltechenterprises.in
A renowned name in the domain of Cooling Pads, ABS Ductable Cooling Machine, Desert/Room Coolers, etc., Cool Tech Enterprises has been offering quality to the clients. Combining technology and wide... 자세히보기 »
- 보안 제품 대리점 | 전송 인쇄 | 사출 성형 서비스, 금속 | 절연 재료 | 사용자 정의 디자인 온천 | 커플 링 | 파이프 | 파이프 피팅 | 파이프 및 피팅 | 파이프 및 튜브, 주철...
- Amravati
- 인도
supplyautonomy.com/chamundaindustries.in
We are pleased to introduce ourselves as one of the leading Exporters, Manufacturers , Stockists Supplier of stainless steel item,ferrous non-ferrous metal which are required by your company in... 자세히보기 »
- 보안 제품 대리점 | 전송 인쇄 | 사출 성형 서비스, 금속 | 절연 재료 | 사용자 정의 디자인 온천 | 커플 링 | 파이프 | 파이프 피팅 | 파이프 및 피팅 | 파이프 및 튜브, 주철...
- Mumbai
- 인도
supplyautonomy.com/hardikenterprises.in
We, Hardik Enterprises, are a customer oriented company involved in the manufacturing & supplying of premium quality industrial fittings. We started our journey in the year 2012, with an... 자세히보기 »
- 보안 제품 대리점 | 전송 인쇄 | 사출 성형 서비스, 금속 | 절연 재료 | 사용자 정의 디자인 온천 | 커플 링 | 파이프 | 파이프 피팅 | 파이프 및 피팅 | 파이프 및 튜브, 주철...
- Faridabad
- 인도
supplyautonomy.com/acmemachinerycompany.in
ACME machinery company was established in 1961,
started catering mainly to varied Printing Press and later to Packaging Industry as well, around India. The company built its reputation through... 자세히보기 »
- 기타 의류 기계 | 인쇄 및 그래픽 장비 | 골판지 기계를 만드는, 연속, 실린더 | 형, 실린더, 판지 만들기 | 캘린더 기계, 종이 및 판지 만들기 | 마분지 변환 기계, 자동 절단 | 골판지 및 마분지를위한 원...
- Mumbai
- 인도
supplyautonomy.com/ashokenterprise.in
Ashok Enterprise is a reliable firm, known as a trustworthy Trader and Supplier of Garden & Farm Equipment, Engine & Pumpset, Pumps, Generators and Electrical & Control Panels. Our... 자세히보기 »
- 보안 제품 대리점 | 전송 인쇄 | 사출 성형 서비스, 금속 | 절연 재료 | 사용자 정의 디자인 온천 | 커플 링 | 파이프 | 파이프 피팅 | 파이프 및 피팅 | 파이프 및 튜브, 주철...
- Bardoli
- 인도
supplyautonomy.com/graphicarbproducts.in
Empowered by experienced professionals who possess sound knowledge of the latest technology, Graphicarb Products has been functioning since 1990. Our company is acknowledged as the leading... 자세히보기 »
- 보안 제품 대리점 | 전송 인쇄 | 사출 성형 서비스, 금속 | 절연 재료 | 사용자 정의 디자인 온천 | 커플 링 | 파이프 | 파이프 피팅 | 파이프 및 피팅 | 파이프 및 튜브, 주철...
- Ahmedabad
- 인도
supplyautonomy.com/jitamitraelectroenggpvt.in
An Overview Jitamitra Electro Engg Pvt. Ltd. is a part of ZEN Group, which was established in 1993. Operating from a state-of-the-art infrastructural setup at Ahmednagar (Maharashtra), the company is... 자세히보기 »
- 보안 제품 대리점 | 전송 인쇄 | 사출 성형 서비스, 금속 | 절연 재료 | 사용자 정의 디자인 온천 | 커플 링 | 파이프 | 파이프 피팅 | 파이프 및 피팅 | 파이프 및 튜브, 주철...
- Pune
- 인도
supplyautonomy.com/marutienterprise11.in
We, Maruti Enterprise, are working as a prominent Manufacturer and Supplier of Packaging Trays, Food Packaging Trays, Meal Packaging Trays, Blister Forming Packaging, Blister Packaging Tray, Cake... 자세히보기 »
- 보안 제품 대리점 | 전송 인쇄 | 사출 성형 서비스, 금속 | 절연 재료 | 사용자 정의 디자인 온천 | 커플 링 | 파이프 | 파이프 피팅 | 파이프 및 피팅 | 파이프 및 튜브, 주철...
- Kalol
- 인도
supplyautonomy.com/akshardhamindustries.in
Manufacturer and Exporters of Multi Colour Gravure Printing Press, Lamination and Slitting Machines.
- 인쇄 및 그래픽 장비 | 인쇄 프레스, 실린더, 단 하나 회전 | 인쇄 프레스, 실린더, 두 혁명 | 인쇄 프레스, 실린더, 정지 실린더 | 인쇄 프레스, 플래 튼 | 인쇄 프레스, 가공, 조리실 | 인쇄 프레스, ...
- Wadhwan
- 인도
supplyautonomy.com/angelindiacadcampvt.in
Manufacturer, Exporters & Importers of Cutting Plotters, Laser Engravers, Laser Market, CNC Router, Fiber Laser, Laser Welder, Inkjet Printers, Solvent Printer and All kinds of Ink for... 자세히보기 »
- 가방 | 젖은 김이 기계, 섬유 | 마른 김이 기계, 섬유 | 김 기기, 저압, 섬유 | 김 상자, 섬유 | 김 테이블, 직물 | 스팀 맹 글링 기계, 섬유 | Stenters / tenters, 김, 섬유 | 김 ...
- New Delhi
- 인도
supplyautonomy.com/gurusalescorporation.in
With extensive industry experience and in-depth knowledge, we, Guru Sales Corporation have established ourselves among the leading suppliers and service providers of high quality Granite Tiles, Solar... 자세히보기 »
- 보안 제품 대리점 | 전송 인쇄 | 사출 성형 서비스, 금속 | 절연 재료 | 사용자 정의 디자인 온천 | 커플 링 | 파이프 | 파이프 피팅 | 파이프 및 피팅 | 파이프 및 튜브, 주철...
- Ilkal
- 인도
supplyautonomy.com/gehlotworks.in
Manufacturers and Exporters of Flexo Graphic and Roto-Gravure Printing Machines.
- 수입 - 수출, 종이 | 화장지 | 냅킨, 손수건 화장지, 셀룰로스 워딩 | 화장지, moisturised | 물티슈, 종이, 산업, 일회용 | 일반 간호 응용 프로그램에 대한 물티슈, 종이, | 물티슈, 종이, 임...
- Jodhpur
- 인도
supplyautonomy.com/laxmiudyog.in
- 보안 제품 대리점 | 전송 인쇄 | 사출 성형 서비스, 금속 | 절연 재료 | 사용자 정의 디자인 온천 | 커플 링 | 파이프 | 파이프 피팅 | 파이프 및 피팅 | 파이프 및 튜브, 주철...
- Mumbai
- 인도
supplyautonomy.com/engineersudyog.in
With extensive technical expertise and a well maintained infrastructure, we, Modern Industries, have carved an eminent position in the competitive market. We are reckoned as a prominent manufacturer,... 자세히보기 »
- 커플 링 | 볼 밸브 | 버터 플라이 밸브 | 컨베이어 벨트, 섬유 시멘트 | 파이버 시멘트 제품, 화재 방지 | 인쇄 및 그래픽 장비 | 미끄럼 베어링 | 비철 금속 제품...
- Howrah
- 인도
supplyautonomy.com/lineomaticgraphicindustries.in
Welcome to the world of precision perfection. commitment assurance. innovation excellence. quality and originality.
Line O Matic Graphic Industries has always been a precursor in introducing... 자세히보기 »
- 인쇄 및 그래픽 장비 | 종이 가공 기계 | 프린터 및 바인더
- Ahmedabad
- 인도
supplyautonomy.com/wenzhouduke.cn
Wenzhou Duke Import Export Co., ltd is Located in the Ruian city .We specialized in supplying plastic production machine,auto parts,shopping bags and so on ,especially the brake pads and film... 자세히보기 »
- 스트레치 필름 | 인쇄 및 그래픽 장비 | 포장 기계
- Wenzhou
- 중국
supplyautonomy.com/cangzhoutongbaocartonmachineryco.cn
Our corporation specializes in the development and production of cardboard machinery in Northern China. There are 280 employees in our corporation now and 68 staff members specialize in scientific... 자세히보기 »
- 인쇄 및 그래픽 장비 | 종이 가공 기계 | 밀링 금속 용 기계
- Cangzhou
- 중국
supplyautonomy.com/vicstarmachinerygroup.cn
Shenzhen Vicstar Imp. Exp. Co., Ltd. is specialized in manufacturing of packaging and printing machines, as one of the backbone enterprises in packaging and printing industries in China.
Our... 자세히보기 »
- 인쇄 및 그래픽 장비 | 레이저 장비
- Shenzhen
- 중국
supplyautonomy.com/taixinglianbangprintingproductsco.cn
PS and CTP Plate is the most comprehensive applied offset plate in the printing industry,China has been developed into a world manufacture plant of offset plate.LianBang Printing Products Co.,Ltd... 자세히보기 »
- 세척 장비 | 인쇄 및 그래픽 장비
- Taixing
- 중국
supplyautonomy.com/ruianweiguoprintingpackagingmachineryfactory.cn
Wenzhou Qiangtuo Machinery Co., Ltd. (Ruian Weiguo Machinery Pakage Factory) is a professional manufacturer of printing machines, film-blowing machines, bag-making machines, slitting machines and... 자세히보기 »
- 인쇄 및 그래픽 장비 | 기타 자료 처리 장비
- Wenzhou
- 중국
supplyautonomy.com/ruianwanyuanpackingmachineco.cn
We are a manufacturer of non woven bag-making machines with well-equipped testing equipment and strong technical force. With a wide range, good quality, reasonable prices and stylish designs, our... 자세히보기 »
- 가방 기계 만들기 | 인쇄 및 그래픽 장비
- Ruian
- 중국
supplyautonomy.com/ruianlishengprintingpackagingmachineryco.cn
Ruian Lisheng Prining Packing Machinery Factory is an enterprise producing complete sets of plastic soft packing and paper packing equipment. Taking science and technology as support, customer... 자세히보기 »
- 가방 기계 만들기 | 인쇄 및 그래픽 장비
- Ruian
- 중국
supplyautonomy.com/ruianjiangnanmachineryco.cn
As high quality needs of lifr today,beautifully packaged required by everything.Ruian ZHEREN Printing Machine Co,.Ltd.were set up,located in the East China Sea,"Ruian City"
ZHEREN... 자세히보기 »
- 가방 기계 만들기 | 인쇄 및 그래픽 장비
- Ruian
- 중국
supplyautonomy.com/cheungwohingprintingmachineryco.cn
Established in 1995, Cheung Wo Hing Printing Machinery Co., Ltd. (CWH) is a large-scale company based on Hong Kong capital. We concentrate on the RD, manufacturing, and marketing of professional... 자세히보기 »
- 인쇄 및 그래픽 장비 | 기계 제작 종이 제품
- Dongguan
- 중국
supplyautonomy.com/wenzhouounuopackingmachineryco.cn
Wenzhou Ounuo Machinery Co., Ltd. is a professional manufacturer of fully automatic non-woven bag making machines, Paper cup machine,Non woven Screen printing Machine,Nonwoven printing machines,... 자세히보기 »
- 자루 및 가방 | 재봉 기계 | 인쇄 및 그래픽 장비 | 포장 기계
- Wenzhou
- 중국
supplyautonomy.com/ntexengineeringworkspvt.in
N-TEX Group focuses on productivity, providing flexible solutions wherever resources, performance and interaction requirements permit. By translating a deep understanding of our customers'... 자세히보기 »
- 기타 섬유 기계 | 인쇄 및 그래픽 장비
- Ahmedabad
- 인도
supplyautonomy.com/xlplastics.in
We are pleased to Introduce ourselves and it would not be out of place to say that we are one of the leading manufacturers of Plastic Film converting machinery in the Asian Sub Continent. We have... 자세히보기 »
- 가방 기계 만들기 | 인쇄 및 그래픽 장비 | 포장 기계
- Vadodara
- 인도
supplyautonomy.com/krishnaengineeringworks6.in
We are pleased to introduce ourselves as one of the leading manufacturers of Plastic Packaging, Paper Converting, Textile Processing Tyre Cord machineries from India. Please visit us at WWW.... 자세히보기 »
- 직물 끝 마무리 기계 | 인쇄 및 그래픽 장비 | 포장 기계
- Ahmedabad
- 인도
supplyautonomy.com/jayomaindustries.in
JAYOMA INDUSTRIES is Manufacturers and Exporter of Textile Screen Both Of Rotary And Flat screen Machinery and Spares. And Also Manufacturing Flexo Plate making Equipments. JAYOMA is Established in... 자세히보기 »
- 인쇄 및 그래픽 장비 | 시멘트 가방 | 전기 및 전자 장비
- Ahmedabad
- 인도