Loading...
Search Results for: Manufacture of chemicals and chemical products
Found 488 companiesRelated categories
supplyautonomy.com/univar.fr
- Chemicals - import-export | Protein purification services | Sieving of pastes for the chemical industry | Air...
- Fontenay-sous-Bois
- France
supplyautonomy.com/sofresidengineering.fr
- Pipework contractors, chemical and nuclear effluent systems | Pipework installation contractors, chemical plant |...
- Montigny-le-Bretonneux
- France
supplyautonomy.com/sweco.us
- Sieving of solids for the chemical industry | Humidifiers, meal, edible vegetable oil processing | Heaters, edible...
- Florence
- United States
supplyautonomy.com/hosokawamicronlimited.gb
Hosokawa Micron Ltd is your single source for integrated powder processing systems and containment solutions. Our core products and services include particle design for nano technology, size... Read More »
- Mixing and blending technology engineering consultants | Production services, dietary supplements | Blending of...
- Runcorn
- United Kingdom
supplyautonomy.com/gujaratfluorochemicalslimited.in
Gujarat Fluorochemicals Limited (GFL) is an Indian Chemicals Company with over 30 years of expertise in Fluorine Chemistry. GFL holds domain expertise in Fluoropolymers, Fluorospecialities,... Read More »
- Production of chemicals | Chemicals
- Noida
- India
supplyautonomy.com/texmor.mx
In 1981, the painting factory Permil S.A. of C.V. I think you will sit in the market of the surest. Our mission is to protect and decorate beautifully designed motifs for the three brothers, written... Read More »
- Manufacture of dyes and pigments | Manufacture of paints, varnishes and similar coatings, printing ink and mastics |...
- Xochitepec
- Mexico
supplyautonomy.com/embelezarkosmetikinstitut.ca
So wie ich mir für meine Haut nur das Beste gönne, lege ich auch in meinem Kosmetikstudio in Frankfurt größten Wert auf die Qualität meiner kosmetischen Produkte und Behandlungen. Als langjährig erfah... Read More »
- Cosmetic treatment services | Cosmetics processing
- Frankfurt am Main
- Germany
supplyautonomy.com/shandongrunkechemicalco.cn
Shandong Runke Chemical Co., Ltd. was established in 2006 and finished holding and restructuring of Weifang Dacheng Salinization Co., Ltd. to the company in 2010. With a registered capital of 40... Read More »
- Manufacture of other chemical products n.e.c. | Chemical products | Bromine, solid, liquid or gaseous
- Weifang
- China
supplyautonomy.com/shandongsunshinechemicaltechnologyco.cn
Shandong Sunshine Chemical Technology Co., Ltd. specializes in R&D, production and management of disinfectant, additives and polymer, and its factory was built in accordance with GMP standards.... Read More »
- Manufacture of other chemical products n.e.c. | Chlorine generators for swimming pools | Chemical products |...
- Yanggu
- China
supplyautonomy.com/northeastagrochem.cn
Agrochemicals products.
Main products: Malathion, Chlorpyrifos, Thiamethoxam, and others. (Technical and Formulation)
Aгрохимикатов продукции.
Основная продукция: Малатион, Хлорпирифос, Тиаметокса... Read More »
- Manufacture of pesticides and other agrochemical products | Agrochemicals | Agrochemical | Other agrochemicals and...
- Jinxi
- China
supplyautonomy.com/chemiplastinternational.pk
Chemiplast International is a strong, family rooted company – founded by a cotton trading veteran Mr. Abid Ali (late) in 1999 with a vision to make Chemiplast one of the leading trading companies ... Read More »
- Polyurethane (PU) | Polymers | Solvents | Manufacture of other chemical products | Manufacture of chemicals and...
- Karachi
- Pakistan
supplyautonomy.com/varunpolymers.in
Varun Polymers is one of the leading manufacturer and exporter in India, of premium quality recycled rubber products. We manufacture rubber reclaiming agent such as:
1 Di Aryl Di Sulphide
2 ... Read More »
- Custom chemical services | Ball valves | Plastic products | Adhesives and tape | Moulded components, fused quartz
- Ahmedabad
- India
supplyautonomy.com/todecasa.es
- Classification services, fine chemicals | Distillation of chemicals | Yeast for the beverage industry | Yeast, bakers'...
- Barcelona
- Spain
supplyautonomy.com/eastmanchemicalcompany.us
- Custom chemical services | Sodium, liquid | Sodium metabisulphite/sodium pyrosulphite | Sodium methoxide/sodium...
- Kingsport
- United States
supplyautonomy.com/sudarshandhoopp.in
Manufacturers and Exporters of Incense Products like Dhoop, Agarbathi Coils and Cones, Extruded Bambooless Sticks, Incense Sticks, Magical Charcoal Tablets, Pure Natural Agarbatti, Incense Gift Sets... Read More »
- Production services, dietary supplements | Filling and packaging services, solvents and adhesives, industrial |...
- New Delhi
- India
supplyautonomy.com/stridesarcolab.in
Manufacturer, Exporters and Importers of Antibiotics, Cephalophins, Nutracentieah, HIV Rearoviral, Vitamins, Soft Gelatin Capsule, Tablet, Liquid Injection, Dry Powder Injection, Oral Solid Dosage... Read More »
- Production services, dietary supplements | Blending of pharmaceuticals | Spray drying of pharmaceuticals | Protein...
- Bengaluru
- India
supplyautonomy.com/islandwidemarketingservicespvt.lk
Import & Supply of Industrial Chemicals,Machinery Lab Equipment,Packaging along with the Technological Inputs & Clearing & Forwarding Agents,Export of Coconut based... Read More »
- Recovery and regeneration of volatile organic compounds (VOC) | Protein purification services | Sieving of liquids for...
- Rajagiriya
- Sri Lanka
supplyautonomy.com/developpementbernardplasencia.fr
- Pharmaceutical production engineering consultants | Biochemical engineering consultants | Regeneration services for...
- Saint-Priest
- France
supplyautonomy.com/aircontrolsa.es
- Cooling plant, turnkey projects | Production services, dietary supplements | Blending of pharmaceuticals | Spray drying...
- San Sebastián
- Spain
supplyautonomy.com/borgessa.es
- Grouting, plaster based | Production services, dietary supplements | Commodity merchants, raw rubber and latex |...
- Reus
- Spain
supplyautonomy.com/crealis.fr
- Management advice | Distillation of chemicals | Cleaning products, chemical, for electric and electronic installations...
- Bry
- France
supplyautonomy.com/novissrl.it
- Synthesising services, chemical | Chromating chemicals for metals | Chromium plating chemicals | Additives, chemical,...
- Calenzano
- Italy
supplyautonomy.com/azelisfrance.fr
- Production services, dietary supplements | Chemicals - import-export | Blending of pharmaceuticals | Spray drying of...
- Paris
- France
supplyautonomy.com/epiingredients.fr
- Blending of pharmaceuticals | Blending of paints and pigments for the chemical industry | Ginger oil | Powdered and...
- Ancenis
- France
supplyautonomy.com/ktronfrance.fr
- Production services, dietary supplements | Filling and packaging services, solvents and adhesives, industrial |...
- Croissy-sur-Celle
- France
supplyautonomy.com/lgobbisrl.it
- Production services, dietary supplements | Regeneration of catalysts | Regeneration services for activated carbon |...
- CAMPO LIGURE (GE)
- Italy
supplyautonomy.com/toshniwalsystemsandinstrumentsprivatelimited.in
Manufacturers, Exporters & Importers Of Oval Gear Meter, Turbine Flow Meter, Vortex Meter, Density Meter, Cone Meter, Clamp On Ultrasonic Meter, Magnetic Inductive Flow Sensor, Flow Computer,... Read More »
- Production services, dietary supplements | Blending of pharmaceuticals | Spray drying of pharmaceuticals | Protein...
- Chennai
- India
supplyautonomy.com/standardplasticatehnicsrl.ro
- Packaging and filling plant and equipment engineering consultants | Printed circuit board (PCB) and surface mount...
- Bucuresti
- Romania
supplyautonomy.com/spolpharmasro.cz
- Mixing and blending of pastes for the chemical industry | Cutting pastes for stainless steel, synthetic lubricant based...
- Olomouc
- Czech Republic
supplyautonomy.com/nopcopapertechnologysl.es
- Production services, dietary supplements | Recovery of oils and fats from effluent and waste water | Blending of...
- Terrassa
- Spain