Search Results for: Prodhimi i kemikateve dhe produkteve kimike

Kompanitë e gjetura 489


supplyautonomy.com/mediwelllaboratories.in
We are An ISO 9001:2015 , certified and is listed on all Drug updates. Our sister concern are Mediwell wellness , mediwell wellness & Phytomolecules Marcwell Laboratories , All of our... Lexo më shumë »
  • Kozmetikë përpunimit | Ilaç bimor | Ilaçe bimor | Produkte te kujdesit personal | Men Kujdesi | Kozmetikë
  • Ambala City
  • Indi
supplyautonomy.com/sofresidengineering.fr
  • Kontraktuesit gypave, kimike dhe sistemet bërthamore rrjedhës | Kontraktuesit instalimin Gypat, fabrikë kimike | Ko...
  • Montigny-le-Bretonneux
  • Francë
supplyautonomy.com/sweco.us
  • Sieving e solids për industrinë kimike | Humidifiers, miell, vaj ushqimor perimeve | Heaters, oilseed ngrënshëm | Paj...
  • Florence
  • Shtetet e Bashkuara të Amerikës
supplyautonomy.com/sudarshandhoopp.in
Manufacturers and Exporters of Incense Products like Dhoop, Agarbathi Coils and Cones, Extruded Bambooless Sticks, Incense Sticks, Magical Charcoal Tablets, Pure Natural Agarbatti, Incense Gift Sets... Lexo më shumë »
  • Shërbimet e prodhimit, shtojcave dietike | Plotësimi dhe Packaging shërbimeve, tretës dhe ngjitëse, industriale | Përz...
  • New Delhi
  • Indi
supplyautonomy.com/gujaratfluorochemicalslimited.in
Gujarat Fluorochemicals Limited (GFL) is an Indian Chemicals Company with over 30 years of expertise in Fluorine Chemistry. GFL holds domain expertise in Fluoropolymers, Fluorospecialities,... Lexo më shumë »
  • Prodhimi i kimikateve | Kimikatet
  • Noida
  • Indi
supplyautonomy.com/texmor.mx
In 1981, the painting factory Permil S.A. of C.V. I think you will sit in the market of the surest. Our mission is to protect and decorate beautifully designed motifs for the three brothers, written... Lexo më shumë »
  • Prodhimi i ngjyra dhe pigmente | Prodhimin e bojrave, llaqe dhe veshje të ngjashme, ngjyrë shtypje dhe mastice | Bojra d...
  • Xochitepec
  • Meksikë
supplyautonomy.com/embelezarkosmetikinstitut.ca
So wie ich mir für meine Haut nur das Beste gönne, lege ich auch in meinem Kosmetikstudio in Frankfurt größten Wert auf die Qualität meiner kosmetischen Produkte und Behandlungen. Als langjährig erfah... Lexo më shumë »
  • Shërbimet Kozmetike trajtimit | Kozmetikë përpunimit
  • Frankfurt am Main
  • Gjermani
supplyautonomy.com/shandongrunkechemicalco.cn
Shandong Runke Chemical Co., Ltd. was established in 2006 and finished holding and restructuring of Weifang Dacheng Salinization Co., Ltd. to the company in 2010. With a registered capital of 40... Lexo më shumë »
  • Prodhimi i produkteve të tjera kimike n.e.c. | Produktet kimike | Bromine, të ngurta, të lëngshme ose të gazta
  • Weifang
  • Kinë
supplyautonomy.com/shandongsunshinechemicaltechnologyco.cn
Shandong Sunshine Chemical Technology Co., Ltd. specializes in R&D, production and management of disinfectant, additives and polymer, and its factory was built in accordance with GMP standards.... Lexo më shumë »
  • Prodhimi i produkteve të tjera kimike n.e.c. | Gjeneratorë të klorit për pishina | Produktet kimike | Prodhimi i kem...
  • Yanggu
  • Kinë
supplyautonomy.com/northeastagrochem.cn
Agrochemicals products. Main products: Malathion, Chlorpyrifos, Thiamethoxam, and others. (Technical and Formulation) Aгрохимикатов продукции. Основная продукция: Малатион, Хлорпирифос, Тиаметокса... Lexo më shumë »
  • Prodhimi i pesticideve dhe produkteve të tjera agrochemical | Agrochemicals | Agrochemical | Agrochemicals tjera dhe ...
  • Jinxi
  • Kinë
supplyautonomy.com/chemiplastinternational.pk
Chemiplast International is a strong, family rooted company – founded by a cotton trading veteran Mr. Abid Ali (late) in 1999 with a vision to make Chemiplast one of the leading trading companies ... Lexo më shumë »
  • Poliuretani (pu) | Polimere | Tretësit | Prodhimi i produkteve të tjera kimike | Prodhimi i kemikateve dhe produkteve k...
  • Karachi
supplyautonomy.com/varunpolymers.in
Varun Polymers is one of the leading manufacturer and exporter in India, of premium quality recycled rubber products. We manufacture rubber reclaiming agent such as: 1 Di Aryl Di Sulphide 2 ... Lexo më shumë »
  • Custom kimike Shërbimet | Valvulave Ball | Produkteve plastike | Ngjitëse dhe kasetë | Formohem komponente, fused ku...
  • Ahmedabad
  • Indi
supplyautonomy.com/todecasa.es
  • Shërbimet e klasifikimit, kimikatet gjobë | Fermentimi i kimikateve | Maja për industrinë e pijeve | , Maja 'Bakers | Ma...
  • Barcelona
  • Spanjë
supplyautonomy.com/eastmanchemicalcompany.us
  • Custom kimike Shërbimet | , Natriumi të lëngshme | Metabisulphite / natriumi pyrosulphite | Methoxide / natriumi me...
  • Kingsport
  • Shtetet e Bashkuara të Amerikës
supplyautonomy.com/lgobbisrl.it
  • Shërbimet e prodhimit, shtojcave dietike | Rigjenerimin e katalizatorëve | Shërbimet e rigjenerimit për aktivizimit të k...
  • CAMPO LIGURE (GE)
  • Itali
supplyautonomy.com/stridesarcolab.in
Manufacturer, Exporters and Importers of Antibiotics, Cephalophins, Nutracentieah, HIV Rearoviral, Vitamins, Soft Gelatin Capsule, Tablet, Liquid Injection, Dry Powder Injection, Oral Solid Dosage... Lexo më shumë »
  • Shërbimet e prodhimit, shtojcave dietike | Përzierja e farmaceutike | Llak tharje e farmaceutike | Shërbimet e pa...
  • Bengaluru
  • Indi
supplyautonomy.com/islandwidemarketingservicespvt.lk
Import & Supply of Industrial Chemicals,Machinery Lab Equipment,Packaging along with the Technological Inputs & Clearing & Forwarding Agents,Export of Coconut based... Lexo më shumë »
  • Rimëkëmbjes dhe rigjenerimi i komponimeve organike të paqëndrueshme (VOC) | Shërbimet e pastrimit proteinave | Sieving e...
  • Rajagiriya
supplyautonomy.com/developpementbernardplasencia.fr
  • Konsulentëve farmaceutike inxhinieri e prodhimit | Konsulentët inxhinieri biokimike | Shërbimet e rigjenerimit për akt...
  • Saint-Priest
  • Francë
supplyautonomy.com/aircontrolsa.es
  • Bimore ftohjes, projektet e gardian | Shërbimet e prodhimit, shtojcave dietike | Përzierja e farmaceutike | Llak tharje ...
  • San Sebastián
  • Spanjë
supplyautonomy.com/borgessa.es
  • Grouting, suva të bazuar | Shërbimet e prodhimit, shtojcave dietike | Tregtarët mall, Goma të para dhe latex | Tre...
  • Reus
  • Spanjë
supplyautonomy.com/crealis.fr
  • Këshilla Menaxhimi | Fermentimi i kimikateve | Pastrimi produkte kimike, për instalimet elektrike dhe elektronike | P...
  • Bry
  • Francë
supplyautonomy.com/novissrl.it
  • Shërbimet sintetizuar, kimike | Kimikatet Chromating për metale | Plating kimikateve të kromit | Aditivëve, kimike, për ...
  • Calenzano
  • Itali
supplyautonomy.com/azelisfrance.fr
  • Shërbimet e prodhimit, shtojcave dietike | Kimikatet - import-eksport | Përzierja e farmaceutike | Llak tharje e f...
  • Paris
  • Francë
supplyautonomy.com/epiingredients.fr
  • Përzierja e farmaceutike | Përzierja e ngjyra dhe pigmente për industrinë kimike | Vaj xhenxhefil | Qumësht pluhur dhe k...
  • Ancenis
  • Francë
supplyautonomy.com/ktronfrance.fr
  • Shërbimet e prodhimit, shtojcave dietike | Plotësimi dhe Packaging shërbimeve, tretës dhe ngjitëse, industriale | Përz...
  • Croissy-sur-Celle
  • Francë
supplyautonomy.com/hosokawamicronlimited.gb
Hosokawa Micron Ltd is your single source for integrated powder processing systems and containment solutions. Our core products and services include particle design for nano technology, size... Lexo më shumë »
  • Përzierjen dhe përzierja konsulentë Inxhinieri Teknologji | Shërbimet e prodhimit, shtojcave dietike | Përzierja e farm...
  • Runcorn
  • Mbretëria e Bashkuar
supplyautonomy.com/ajantachemicals.in
Manufacturers and Exporters of Agro Chemicals, Organic Chemicals and Inorganic Chemicals.
  • Shërbimet e prodhimit, shtojcave dietike | Përzierja e farmaceutike | Llak tharje e farmaceutike | Shërbimet e pa...
  • New Delhi
  • Indi
supplyautonomy.com/standardplasticatehnicsrl.ro
  • Paketimin dhe mbushje bimore dhe pajisjet Inxhinieri Consultants | Printed Circuit Board (PCB) dhe sipërfaqe mali ...
  • Bucuresti
  • Rumani
supplyautonomy.com/swecoeuropedivisionfrance.fr
  • Sieving e lëngjeve për industrinë kimike | Sieving e solids për industrinë kimike | Sieving i pastave për industrinë kim...
  • VALENCIENNES
  • Francë
supplyautonomy.com/chemineerlimited.gb
  • Përzierjen dhe përzierja e pastave për industrinë kimike | Mixers, eksploziv prodhimit | Tharje pajisje për eksploziv | ...
  • Derby
  • Mbretëria e Bashkuar