ძებნის შედეგები: შეფუთვის მანქანები

ნაპოვნია 4346 კომპანიები


supplyautonomy.com/trustarpharmapackingequipment.cn
Wenzhou Trustar Machinery Technology co.,ltd.is located in Ruian, Wenzhou, the capital of packaging and printing. The factory covers an area of about 7000 square meters and the office building area... დაწვრილებით »
  • შეფუთვის მანქანები
  • Wenzhou
  • ჩინეთი
supplyautonomy.com/tangshankingvidaprintingmachineryco.cn
The outstanding Tangshan Kingvida Printing Machinery Co., Ltd. is a professional manufacturer of printing and packaging machinery. Located in the central area of Beijing,Tianjin and Tangshan.The... დაწვრილებით »
  • ქაღალდის ჭრის - მანქანები და მოწყობილობა | შეფუთვის მანქანები | მუყაოს ვეტო და glueing მანქანები...
  • Yutian County
  • ჩინეთი
supplyautonomy.com/zhejiangruianyongtaipackingmachinerymanufactureco.cn
Zhejiang Ruian Yongtai Packing Machinery Manufacture Co., Ltd is specialized in producing complete sets of flexible packaging equipment and has a long history. We specially produce various plastic... დაწვრილებით »
  • ჩანთა მიღების მანქანა | ჩანთა მიღების ტექნიკის ნაწილები | ბეჭდვის მანქანები | გოფრირებული მუყაოს პაკეტი საცხობი დანადგარ...
  • Wenzhou
  • ჩინეთი
supplyautonomy.com/guangdongqishengmachineryco.cn
  • Shrink ფილმი შეფუთვა მანქანები | შეფუთვის მანქანები | მრავალფუნქციური შეფუთვა მანქანა | შეფუთვა მანქანები | შეფუთვა და შ...
  • Foshan
  • ჩინეთი
supplyautonomy.com/lindumpackaging1.gb
We analyse what constraints are preventing our customers from achieving optimum efficiency. We know that they need the right products, in the right place, at the right time. Production Can’t Stop ... დაწვრილებით »
  • შეფუთვის კვლევის კონსულტანტები | ატესტაცია პაკეტები და შეფუთვა მასალები | შეფუთვის მომსახურება | შემთხვევები და ყუთების ...
  • Stallingborough, North East Lincolnshire
  • დიდი ბრიტანეთი
supplyautonomy.com/soonkpackagingmachine.cn
Foshan Soonk Packaging Machine Co., Ltd. is a professional advanced enterprise engaged in packaging machine research and development, design, production, sales and maintenance.
  • შეფუთვის მანქანები და მოწყობილობა, მეორადი | გადახურვის და შეფუთვა - მანქანები და მოწყობილობა | შეფუთვა და დაფასოება - მ...
  • Foshan
  • ჩინეთი
supplyautonomy.com/tubitexspa.it
Paperboard tubes and cores - Packaging articles and products - Paperboard cases and boxes for packaging
  • ქაღალდის, fibreboard | მილები, ქაღალდისა და fibreboard | მილები, ქაღალდისა და fibreboard, ჭრილობა | მილები, fibreboard, ...
  • Zona Industriale
  • იტალია
supplyautonomy.com/antoniodominicifratellicostruzionimeccanichesrl.it
Production of machinery for the baking and food industries. Robotized systems for handling, chocolate egg wrappers, chocolate coin wrappers, nougat cookers and cutters, bakery machinery, automatic... დაწვრილებით »
  • Kneading მანქანები პურის და საკონდიტრო მიღების | Kneading და აერთიანებს მანქანები და მოწყობილობა, საკონდიტრო | MOULDING ...
  • Perugia
  • იტალია
supplyautonomy.com/bidllc.ua
BID company - Pasta and packaging equipment manufacture Dear Sirs! The distinctive mark of our company is a wide range of pasta, drying and packaging equipment, which allows to produce pasta... დაწვრილებით »
  • Kneading მანქანები პურის და საკონდიტრო მიღების | კვების მრეწველობის მოწყობილობები და აღჭურვილობები nes | მანქანები საფონ...
  • Dnepropetrovsk
  • უკრაინა
supplyautonomy.com/rakshapackaging.in
The company formed in the year 1976 as a-class ancillary suppliers diversified into the field of packaging by the name of Raksha Packaging in the year 1994. The growth in packaging industry is far... დაწვრილებით »
  • კარიერა, პლასტმასის, ამისთვის პიცა მიწოდება | ფილმი, პლასტიკური, ამისთვის საკვები | ჩანთები, პლასტიკური, ამისთვის საკვებ...
  • Faridabad
  • ინდოეთი
supplyautonomy.com/riddhipharmamachinery.in
Manufacturers and Exporters of Pharmaceutical Machineries. Our multitude of products include Pharmaceutical Machinery, Tablet Press Machine, Rotary Tablet Press Machine, Fluid Bed Dryer, Tray drier,... დაწვრილებით »
  • კვების მრეწველობის მოწყობილობები და აღჭურვილობები nes | Extruders, ფარმაცევტული და კოსმეტიკური ინდუსტრიის | ნავთობის გად...
  • Mumbai
  • ინდოეთი
supplyautonomy.com/acmemachineryindiapvt.in
Acme Machinery (India) Pvt. Ltd. is a professionally managed organization accredited for manufacturing and exporting of Paper Board Printing, Packaging and Converting Machineries since... დაწვრილებით »
  • მუყაო საცხობი დანადგარები, უწყვეტი, ცილინდრიანი | Moulds, ცილინდრიანი, მუყაოს მიღების | Calendering მანქანები, მუყაო და ...
  • Mumbai
  • ინდოეთი
supplyautonomy.com/gdspa.it
G.D is the world's leading cigarette production and packaging machinery constructor. Its vast array of solutions makes G.D. the only company in a position to offer complete high-speed lines.
  • Moisturisers, ფეხსაცმელი წარმოების | სიცხის ქარხნის დაჭრილი თამბაქოს | Condensers, საკვებში გამოსაყენებლად უვარგისი ზეთი...
  • Bologna
  • იტალია
supplyautonomy.com/reconmachinetoolspvt.in
Recon is a leading manufacturer of Plant and Machinery for Metal Cans, Metal Closures Steel Drums, also complete packaging lines for powder, liquid paste in metal containers. Established in the... დაწვრილებით »
  • Composite შეგიძლიათ მიღების მანქანა | გადმოცემის სისტემები, შეიძლება და lid | შეუძლია და cask დასუფთავებისა და სარეცხი მ...
  • Mumbai
  • ინდოეთი
supplyautonomy.com/assopackmachines.in
We have created a niche among quality-oriented corrugators. Our name inspires confidence not only among Indian corrugators but it is known for its reliability of its products in foreign markets... დაწვრილებით »
  • Reeling, ლიკვიდაცია და rewinding მანქანები, Papermaking | ლიკვიდაცია, rewinding და ჭრის მანქანები, მრავალ ფუნქციონირებს,...
  • Ahmedabad
  • ინდოეთი
supplyautonomy.com/gangasinghengineeringpvt.in
ESSGEE Exports is a proprietary concern established in 1993 and are very strong in exporting machinery which are mainly used in tin container industry, packaging industries and having vast knowledge... დაწვრილებით »
  • მშენებელთა ინსტრუმენტები | კვების მრეწველობის მოწყობილობები და აღჭურვილობები nes | კარგად საბურღი დანადგარები | სხვა ტექ...
  • Mumbai
  • ინდოეთი
supplyautonomy.com/apsaraengineers.in
We the manufacturers and exporters of all kinds of textile related machinery, we are specialist in polyfill opening machinery, pillow packing machinery and blowfill machines in nominal cost. We... დაწვრილებით »
  • კოჭები, bobbins, კონუსები, პლასტმასის, ტექსტილის მანქანა | Spinning მილები, პლასტიკური | ბარათის და ხატვის cans, პლასტიკ...
  • Coimbatore
  • ინდოეთი
supplyautonomy.com/foshancitycoretamppackingmachineryco.cn
Foshan Coretamp Packaging Machinery Co.,Ltd. is located in China Machinery Center - Foshan city, takes 30 minutes to Guangzhou and 2 hours to Shenzhen/Hong Kong. We are a leading manufacturer of all k... დაწვრილებით »
  • შეფუთვის მანქანები
  • Foshan
  • ჩინეთი
supplyautonomy.com/excellpacks.in
Welcome Empowering people through prosperity and helping them create wealth have been the mission of VK Engineering & Company since 2000 VK Engineering & Company and heir... დაწვრილებით »
  • შეფუთვა და დაფასოება - მანქანები და მოწყობილობა | შეფუთვის მანქანები და მოწყობილობა | შეფუთვის მანქანები | შეფუთვის ტექნ...
  • Coimbatore, Tamil Nādu
  • ინდოეთი
supplyautonomy.com/cooltechenterprises.in
A renowned name in the domain of Cooling Pads, ABS Ductable Cooling Machine, Desert/Room Coolers, etc., Cool Tech Enterprises has been offering quality to the clients. Combining technology and wide... დაწვრილებით »
  • უსაფრთხოების პროდუქტის აგენტები | გადაცემის ბეჭდვა | ინჟექტორი ჩამოსხმა მომსახურება, რკინის | საიზოლაციო მასალები | საბა...
  • Amravati
  • ინდოეთი
supplyautonomy.com/chamundaindustries.in
We are pleased to introduce ourselves as one of the leading Exporters, Manufacturers , Stockists Supplier of stainless steel item,ferrous non-ferrous metal which are required by your company in... დაწვრილებით »
  • უსაფრთხოების პროდუქტის აგენტები | გადაცემის ბეჭდვა | ინჟექტორი ჩამოსხმა მომსახურება, რკინის | საიზოლაციო მასალები | საბა...
  • Mumbai
  • ინდოეთი
supplyautonomy.com/preciousmineralprocessingsystemspvt.in
CHITRA PHARMA MACHINERY PRECIOUS FAB-CAST PVT. LTD. , the parent company of CHITRA PHARMA MACHINERY-an ISO 9001: 2000 company is the designer, developer, manufacturer and exporter of various... დაწვრილებით »
  • დასუფთავების აღჭურვილობა | კვების მრეწველობის მოწყობილობები და აღჭურვილობები nes | კარგად საბურღი დანადგარები | მანქანა ...
  • Ahmedabad
  • ინდოეთი
supplyautonomy.com/kusodalamuthucopvt.in
Bharath Paper Conversions are manufacturers and exporters of high quality Paper Cones, Paper Tubes, Paper Cores, Edge Protectors, Composite Cans and Pulp Moulded Products. Established in 1984, the... დაწვრილებით »
  • ქაღალდის, fibreboard | მილები, ქაღალდისა და fibreboard | მილები, ქაღალდისა და fibreboard, ჭრილობა | მილები, fibreboard, ...
  • Coimbatore
  • ინდოეთი
supplyautonomy.com/seniorprintpackmachineryco.in
Manufacturers & Exporters Of Corrugated Board, Box Making Machinery, Corrugated Board Making Plant, Die Punching, Cutting, Creasing & Embossing Machine, Hot Foil Stamping Die Cutting... დაწვრილებით »
  • ჩანთა მიღების მანქანა | ბეჭდვა და გრაფიკული აღჭურვილობა | ქაღალდის დახარისხება მანქანები და მოწყობილობა | ჩამოყალიბებული...
  • Hyderabad
  • ინდოეთი
supplyautonomy.com/finopack.cn
An open mouth bagging machine is an automatic filling and sealing machine which fills products into bags up to a specific weight, and closes the bag mouth automatically. Our automatic bagging and... დაწვრილებით »
  • შეფუთვის მანქანები და მოწყობილობა | შეფუთვის მანქანები | შეფუთვის ტექნიკის ნაწილები...
  • Hefei
  • ჩინეთი