Результати пошуку для: Обладнання для друку та дизайну графічного
Знайдено 277 компаніїПереважний оголошень, пов'язаних з: Обладнання для друку та дизайну графічного
supplyautonomy.com/seniorprintpackmachineryco.in
Manufacturers & Exporters Of Corrugated Board, Box Making Machinery, Corrugated Board Making Plant, Die Punching, Cutting, Creasing & Embossing Machine, Hot Foil Stamping Die Cutting... Детальніше »
- Механізм виготовлення сумки | Обладнання для друку та дизайну графічного | Машини та обладнання для сортування, разбрако...
- Hyderabad
- Індія
supplyautonomy.com/cooltechenterprises.in
A renowned name in the domain of Cooling Pads, ABS Ductable Cooling Machine, Desert/Room Coolers, etc., Cool Tech Enterprises has been offering quality to the clients. Combining technology and wide... Детальніше »
- Агенти по продуктах безпеки | Перекладна друк | Послуги ливарного металів | Ізоляційні матеріали | Пружини на замовлення...
- Amravati
- Індія
supplyautonomy.com/chamundaindustries.in
We are pleased to introduce ourselves as one of the leading Exporters, Manufacturers , Stockists Supplier of stainless steel item,ferrous non-ferrous metal which are required by your company in... Детальніше »
- Агенти по продуктах безпеки | Перекладна друк | Послуги ливарного металів | Ізоляційні матеріали | Пружини на замовлення...
- Mumbai
- Індія
supplyautonomy.com/hardikenterprises.in
We, Hardik Enterprises, are a customer oriented company involved in the manufacturing & supplying of premium quality industrial fittings. We started our journey in the year 2012, with an... Детальніше »
- Агенти по продуктах безпеки | Перекладна друк | Послуги ливарного металів | Ізоляційні матеріали | Пружини на замовлення...
- Faridabad
- Індія
supplyautonomy.com/acmemachinerycompany.in
ACME machinery company was established in 1961,
started catering mainly to varied Printing Press and later to Packaging Industry as well, around India. The company built its reputation through... Детальніше »
- Інші швейні машини | Обладнання для друку та дизайну графічного | Машини картоноробні круглосіткових безперервної дії | ...
- Mumbai
- Індія
supplyautonomy.com/ashokenterprise.in
Ashok Enterprise is a reliable firm, known as a trustworthy Trader and Supplier of Garden & Farm Equipment, Engine & Pumpset, Pumps, Generators and Electrical & Control Panels. Our... Детальніше »
- Агенти по продуктах безпеки | Перекладна друк | Послуги ливарного металів | Ізоляційні матеріали | Пружини на замовлення...
- Bardoli
- Індія
supplyautonomy.com/graphicarbproducts.in
Empowered by experienced professionals who possess sound knowledge of the latest technology, Graphicarb Products has been functioning since 1990. Our company is acknowledged as the leading... Детальніше »
- Агенти по продуктах безпеки | Перекладна друк | Послуги ливарного металів | Ізоляційні матеріали | Пружини на замовлення...
- Ahmedabad
- Індія
supplyautonomy.com/jitamitraelectroenggpvt.in
An Overview Jitamitra Electro Engg Pvt. Ltd. is a part of ZEN Group, which was established in 1993. Operating from a state-of-the-art infrastructural setup at Ahmednagar (Maharashtra), the company is... Детальніше »
- Агенти по продуктах безпеки | Перекладна друк | Послуги ливарного металів | Ізоляційні матеріали | Пружини на замовлення...
- Pune
- Індія
supplyautonomy.com/marutienterprise11.in
We, Maruti Enterprise, are working as a prominent Manufacturer and Supplier of Packaging Trays, Food Packaging Trays, Meal Packaging Trays, Blister Forming Packaging, Blister Packaging Tray, Cake... Детальніше »
- Агенти по продуктах безпеки | Перекладна друк | Послуги ливарного металів | Ізоляційні матеріали | Пружини на замовлення...
- Kalol
- Індія
supplyautonomy.com/akshardhamindustries.in
Manufacturer and Exporters of Multi Colour Gravure Printing Press, Lamination and Slitting Machines.
- Обладнання для друку та дизайну графічного | Машини плоськопечатниє однооборотні | Машини плоськопечатниє двооборотні | ...
- Wadhwan
- Індія
supplyautonomy.com/angelindiacadcampvt.in
Manufacturer, Exporters & Importers of Cutting Plotters, Laser Engravers, Laser Market, CNC Router, Fiber Laser, Laser Welder, Inkjet Printers, Solvent Printer and All kinds of Ink for... Детальніше »
- Сумки та дорожні аксесуари | Машини для вологого пропарювання текстилю | Машини для сухого пропарювання текстилю | Апара...
- New Delhi
- Індія
supplyautonomy.com/gurusalescorporation.in
With extensive industry experience and in-depth knowledge, we, Guru Sales Corporation have established ourselves among the leading suppliers and service providers of high quality Granite Tiles, Solar... Детальніше »
- Агенти по продуктах безпеки | Перекладна друк | Послуги ливарного металів | Ізоляційні матеріали | Пружини на замовлення...
- Ilkal
- Індія
supplyautonomy.com/gehlotworks.in
Manufacturers and Exporters of Flexo Graphic and Roto-Gravure Printing Machines.
- Імпортери та експортери папери | Туалетний папір | Пелюшки, носові хустки та косметичні серветки з целюлозної вати | Пап...
- Jodhpur
- Індія
supplyautonomy.com/laxmiudyog.in
- Агенти по продуктах безпеки | Перекладна друк | Послуги ливарного металів | Ізоляційні матеріали | Пружини на замовлення...
- Mumbai
- Індія
supplyautonomy.com/engineersudyog.in
With extensive technical expertise and a well maintained infrastructure, we, Modern Industries, have carved an eminent position in the competitive market. We are reckoned as a prominent manufacturer,... Детальніше »
- Зв'язки | Крани з кульовим краном | Поворотні затвори | Стрічки конвеєрні фіброцементні | Вироби фіброцементні вогнестій...
- Howrah
- Індія
supplyautonomy.com/lineomaticgraphicindustries.in
Welcome to the world of precision perfection. commitment assurance. innovation excellence. quality and originality.
Line O Matic Graphic Industries has always been a precursor in introducing... Детальніше »
- Обладнання для друку та дизайну графічного | Машина обробки паперових продуктів | Принтери й сполучні...
- Ahmedabad
- Індія
supplyautonomy.com/wenzhouduke.cn
Wenzhou Duke Import Export Co., ltd is Located in the Ruian city .We specialized in supplying plastic production machine,auto parts,shopping bags and so on ,especially the brake pads and film... Детальніше »
- Витяжні плівки | Обладнання для друку та дизайну графічного | Пакувальне обладнання...
- Wenzhou
- Китай
supplyautonomy.com/cangzhoutongbaocartonmachineryco.cn
Our corporation specializes in the development and production of cardboard machinery in Northern China. There are 280 employees in our corporation now and 68 staff members specialize in scientific... Детальніше »
- Обладнання для друку та дизайну графічного | Машина обробки паперових продуктів | Верстати для фрезерування металу...
- Cangzhou
- Китай
supplyautonomy.com/vicstarmachinerygroup.cn
Shenzhen Vicstar Imp. Exp. Co., Ltd. is specialized in manufacturing of packaging and printing machines, as one of the backbone enterprises in packaging and printing industries in China.
Our... Детальніше »
- Обладнання для друку та дизайну графічного | Лазерне обладнання
- Shenzhen
- Китай
supplyautonomy.com/taixinglianbangprintingproductsco.cn
PS and CTP Plate is the most comprehensive applied offset plate in the printing industry,China has been developed into a world manufacture plant of offset plate.LianBang Printing Products Co.,Ltd... Детальніше »
- Устаткування для очищення | Обладнання для друку та дизайну графічного...
- Taixing
- Китай
supplyautonomy.com/ruianweiguoprintingpackagingmachineryfactory.cn
Wenzhou Qiangtuo Machinery Co., Ltd. (Ruian Weiguo Machinery Pakage Factory) is a professional manufacturer of printing machines, film-blowing machines, bag-making machines, slitting machines and... Детальніше »
- Обладнання для друку та дизайну графічного | Інше обладнання обробки матеріалів...
- Wenzhou
- Китай
supplyautonomy.com/ruianwanyuanpackingmachineco.cn
We are a manufacturer of non woven bag-making machines with well-equipped testing equipment and strong technical force. With a wide range, good quality, reasonable prices and stylish designs, our... Детальніше »
- Механізм виготовлення сумки | Обладнання для друку та дизайну графічного...
- Ruian
- Китай
supplyautonomy.com/ruianlishengprintingpackagingmachineryco.cn
Ruian Lisheng Prining Packing Machinery Factory is an enterprise producing complete sets of plastic soft packing and paper packing equipment. Taking science and technology as support, customer... Детальніше »
- Механізм виготовлення сумки | Обладнання для друку та дизайну графічного...
- Ruian
- Китай
supplyautonomy.com/ruianjiangnanmachineryco.cn
As high quality needs of lifr today,beautifully packaged required by everything.Ruian ZHEREN Printing Machine Co,.Ltd.were set up,located in the East China Sea,"Ruian City"
ZHEREN... Детальніше »
- Механізм виготовлення сумки | Обладнання для друку та дизайну графічного...
- Ruian
- Китай
supplyautonomy.com/cheungwohingprintingmachineryco.cn
Established in 1995, Cheung Wo Hing Printing Machinery Co., Ltd. (CWH) is a large-scale company based on Hong Kong capital. We concentrate on the RD, manufacturing, and marketing of professional... Детальніше »
- Обладнання для друку та дизайну графічного | Машини для виготовлення паперової продукції...
- Dongguan
- Китай
supplyautonomy.com/wenzhouounuopackingmachineryco.cn
Wenzhou Ounuo Machinery Co., Ltd. is a professional manufacturer of fully automatic non-woven bag making machines, Paper cup machine,Non woven Screen printing Machine,Nonwoven printing machines,... Детальніше »
- Мішки і пакети | Швейні машини | Обладнання для друку та дизайну графічного | Пакувальне обладнання...
- Wenzhou
- Китай
supplyautonomy.com/ntexengineeringworkspvt.in
N-TEX Group focuses on productivity, providing flexible solutions wherever resources, performance and interaction requirements permit. By translating a deep understanding of our customers'... Детальніше »
- Інші текстильне обладнання | Обладнання для друку та дизайну графічного...
- Ahmedabad
- Індія
supplyautonomy.com/xlplastics.in
We are pleased to Introduce ourselves and it would not be out of place to say that we are one of the leading manufacturers of Plastic Film converting machinery in the Asian Sub Continent. We have... Детальніше »
- Механізм виготовлення сумки | Обладнання для друку та дизайну графічного | Пакувальне обладнання...
- Vadodara
- Індія
supplyautonomy.com/krishnaengineeringworks6.in
We are pleased to introduce ourselves as one of the leading manufacturers of Plastic Packaging, Paper Converting, Textile Processing Tyre Cord machineries from India. Please visit us at WWW.... Детальніше »
- Машини для виготовлення оздоблення текстилю | Обладнання для друку та дизайну графічного | Пакувальне обладнання...
- Ahmedabad
- Індія
supplyautonomy.com/jayomaindustries.in
JAYOMA INDUSTRIES is Manufacturers and Exporter of Textile Screen Both Of Rotary And Flat screen Machinery and Spares. And Also Manufacturing Flexo Plate making Equipments. JAYOMA is Established in... Детальніше »
- Обладнання для друку та дизайну графічного | Мішок цементу | Електротехнічне та електронне обладнання...
- Ahmedabad
- Індія