Riżultati għal: Apparat ta' l-istampar u l-grafika
Kumpaniji 277 FoundListings preferuti relatati ma: Apparat ta' l-istampar u l-grafika
supplyautonomy.com/seniorprintpackmachineryco.in
Manufacturers & Exporters Of Corrugated Board, Box Making Machinery, Corrugated Board Making Plant, Die Punching, Cutting, Creasing & Embossing Machine, Hot Foil Stamping Die Cutting... Aqra Aktar »
- Bag teħid makkinarju | Apparat ta' l-istampar u l-grafika | Paper makkinarju u makkinarju ta 'tqassim | Magni li jbidu (...
- Hyderabad
- Indja
supplyautonomy.com/cooltechenterprises.in
A renowned name in the domain of Cooling Pads, ABS Ductable Cooling Machine, Desert/Room Coolers, etc., Cool Tech Enterprises has been offering quality to the clients. Combining technology and wide... Aqra Aktar »
- Aġenti Prodott Sigurtà | Istampar ta 'trasferiment | Servizzi molding injezzjoni, tal-metall | Materjali ta '...
- Amravati
- Indja
supplyautonomy.com/chamundaindustries.in
We are pleased to introduce ourselves as one of the leading Exporters, Manufacturers , Stockists Supplier of stainless steel item,ferrous non-ferrous metal which are required by your company in... Aqra Aktar »
- Aġenti Prodott Sigurtà | Istampar ta 'trasferiment | Servizzi molding injezzjoni, tal-metall | Materjali ta '...
- Mumbai
- Indja
supplyautonomy.com/hardikenterprises.in
We, Hardik Enterprises, are a customer oriented company involved in the manufacturing & supplying of premium quality industrial fittings. We started our journey in the year 2012, with an... Aqra Aktar »
- Aġenti Prodott Sigurtà | Istampar ta 'trasferiment | Servizzi molding injezzjoni, tal-metall | Materjali ta '...
- Faridabad
- Indja
supplyautonomy.com/acmemachinerycompany.in
ACME machinery company was established in 1961,
started catering mainly to varied Printing Press and later to Packaging Industry as well, around India. The company built its reputation through... Aqra Aktar »
- Makkinarju ilbies ieħor | Apparat ta' l-istampar u l-grafika | Magni kartun teħid, kontinwu, ċilindru | Forom,, teħid ka...
- Mumbai
- Indja
supplyautonomy.com/ashokenterprise.in
Ashok Enterprise is a reliable firm, known as a trustworthy Trader and Supplier of Garden & Farm Equipment, Engine & Pumpset, Pumps, Generators and Electrical & Control Panels. Our... Aqra Aktar »
- Aġenti Prodott Sigurtà | Istampar ta 'trasferiment | Servizzi molding injezzjoni, tal-metall | Materjali ta '...
- Bardoli
- Indja
supplyautonomy.com/graphicarbproducts.in
Empowered by experienced professionals who possess sound knowledge of the latest technology, Graphicarb Products has been functioning since 1990. Our company is acknowledged as the leading... Aqra Aktar »
- Aġenti Prodott Sigurtà | Istampar ta 'trasferiment | Servizzi molding injezzjoni, tal-metall | Materjali ta '...
- Ahmedabad
- Indja
supplyautonomy.com/jitamitraelectroenggpvt.in
An Overview Jitamitra Electro Engg Pvt. Ltd. is a part of ZEN Group, which was established in 1993. Operating from a state-of-the-art infrastructural setup at Ahmednagar (Maharashtra), the company is... Aqra Aktar »
- Aġenti Prodott Sigurtà | Istampar ta 'trasferiment | Servizzi molding injezzjoni, tal-metall | Materjali ta '...
- Pune
- Indja
supplyautonomy.com/marutienterprise11.in
We, Maruti Enterprise, are working as a prominent Manufacturer and Supplier of Packaging Trays, Food Packaging Trays, Meal Packaging Trays, Blister Forming Packaging, Blister Packaging Tray, Cake... Aqra Aktar »
- Aġenti Prodott Sigurtà | Istampar ta 'trasferiment | Servizzi molding injezzjoni, tal-metall | Materjali ta '...
- Kalol
- Indja
supplyautonomy.com/akshardhamindustries.in
Manufacturer and Exporters of Multi Colour Gravure Printing Press, Lamination and Slitting Machines.
- Apparat ta' l-istampar u l-grafika | Preses istampar, ċilindru,-rivoluzzjoni wieħed | Preses istampar, ċilindru, two...
- Wadhwan
- Indja
supplyautonomy.com/angelindiacadcampvt.in
Manufacturer, Exporters & Importers of Cutting Plotters, Laser Engravers, Laser Market, CNC Router, Fiber Laser, Laser Welder, Inkjet Printers, Solvent Printer and All kinds of Ink for... Aqra Aktar »
- basktijiet | Wet magni fwar, tat-tessuti | Magni fwar xott, tessuti | Appliances fwar, pressjoni baxxa, tessuti | Kaxxi...
- New Delhi
- Indja
supplyautonomy.com/gurusalescorporation.in
With extensive industry experience and in-depth knowledge, we, Guru Sales Corporation have established ourselves among the leading suppliers and service providers of high quality Granite Tiles, Solar... Aqra Aktar »
- Aġenti Prodott Sigurtà | Istampar ta 'trasferiment | Servizzi molding injezzjoni, tal-metall | Materjali ta '...
- Ilkal
- Indja
supplyautonomy.com/gehlotworks.in
Manufacturers and Exporters of Flexo Graphic and Roto-Gravure Printing Machines.
- Importaturi-esportaturi, karta | Karta tat-twaletta | Srievet, imkatar u tessuti tal-wiċċ, materjal artab taċ-ċelluloża ...
- Jodhpur
- Indja
supplyautonomy.com/laxmiudyog.in
- Aġenti Prodott Sigurtà | Istampar ta 'trasferiment | Servizzi molding injezzjoni, tal-metall | Materjali ta '...
- Mumbai
- Indja
supplyautonomy.com/engineersudyog.in
With extensive technical expertise and a well maintained infrastructure, we, Modern Industries, have carved an eminent position in the competitive market. We are reckoned as a prominent manufacturer,... Aqra Aktar »
- Irbit tal-pajpijiet | Valvoli bil-ballun | Valvoli ""farfett | Ċineg, siment tal-fibra | Prodotti tas-siment bil-fibra, ...
- Howrah
- Indja
supplyautonomy.com/lineomaticgraphicindustries.in
Welcome to the world of precision perfection. commitment assurance. innovation excellence. quality and originality.
Line O Matic Graphic Industries has always been a precursor in introducing... Aqra Aktar »
- Apparat ta' l-istampar u l-grafika | Makkinarju ipproċessar Paper | Printers & binders
- Ahmedabad
- Indja
supplyautonomy.com/wenzhouduke.cn
Wenzhou Duke Import Export Co., ltd is Located in the Ruian city .We specialized in supplying plastic production machine,auto parts,shopping bags and so on ,especially the brake pads and film... Aqra Aktar »
- Film Stretch | Apparat ta' l-istampar u l-grafika | Makkinarju ippakkjar
- Wenzhou
- Ċina
supplyautonomy.com/cangzhoutongbaocartonmachineryco.cn
Our corporation specializes in the development and production of cardboard machinery in Northern China. There are 280 employees in our corporation now and 68 staff members specialize in scientific... Aqra Aktar »
- Apparat ta' l-istampar u l-grafika | Makkinarju ipproċessar Paper | Għodda mekkanizzata għat-tħin tal-metall
- Cangzhou
- Ċina
supplyautonomy.com/vicstarmachinerygroup.cn
Shenzhen Vicstar Imp. Exp. Co., Ltd. is specialized in manufacturing of packaging and printing machines, as one of the backbone enterprises in packaging and printing industries in China.
Our... Aqra Aktar »
- Apparat ta' l-istampar u l-grafika | Tagħmir ta 'laser
- Shenzhen
- Ċina
supplyautonomy.com/taixinglianbangprintingproductsco.cn
PS and CTP Plate is the most comprehensive applied offset plate in the printing industry,China has been developed into a world manufacture plant of offset plate.LianBang Printing Products Co.,Ltd... Aqra Aktar »
- Tindif tat-tagħmir | Apparat ta' l-istampar u l-grafika
- Taixing
- Ċina
supplyautonomy.com/ruianweiguoprintingpackagingmachineryfactory.cn
Wenzhou Qiangtuo Machinery Co., Ltd. (Ruian Weiguo Machinery Pakage Factory) is a professional manufacturer of printing machines, film-blowing machines, bag-making machines, slitting machines and... Aqra Aktar »
- Apparat ta' l-istampar u l-grafika | Tagħmir ieħor għat-tqandil materjal
- Wenzhou
- Ċina
supplyautonomy.com/ruianwanyuanpackingmachineco.cn
We are a manufacturer of non woven bag-making machines with well-equipped testing equipment and strong technical force. With a wide range, good quality, reasonable prices and stylish designs, our... Aqra Aktar »
- Bag teħid makkinarju | Apparat ta' l-istampar u l-grafika
- Ruian
- Ċina
supplyautonomy.com/ruianlishengprintingpackagingmachineryco.cn
Ruian Lisheng Prining Packing Machinery Factory is an enterprise producing complete sets of plastic soft packing and paper packing equipment. Taking science and technology as support, customer... Aqra Aktar »
- Bag teħid makkinarju | Apparat ta' l-istampar u l-grafika
- Ruian
- Ċina
supplyautonomy.com/ruianjiangnanmachineryco.cn
As high quality needs of lifr today,beautifully packaged required by everything.Ruian ZHEREN Printing Machine Co,.Ltd.were set up,located in the East China Sea,"Ruian City"
ZHEREN... Aqra Aktar »
- Bag teħid makkinarju | Apparat ta' l-istampar u l-grafika
- Ruian
- Ċina
supplyautonomy.com/cheungwohingprintingmachineryco.cn
Established in 1995, Cheung Wo Hing Printing Machinery Co., Ltd. (CWH) is a large-scale company based on Hong Kong capital. We concentrate on the RD, manufacturing, and marketing of professional... Aqra Aktar »
- Apparat ta' l-istampar u l-grafika | Prodotti tal-karti jagħmel makkinarju
- Dongguan
- Ċina
supplyautonomy.com/wenzhouounuopackingmachineryco.cn
Wenzhou Ounuo Machinery Co., Ltd. is a professional manufacturer of fully automatic non-woven bag making machines, Paper cup machine,Non woven Screen printing Machine,Nonwoven printing machines,... Aqra Aktar »
- Xkejjer u boroż | Magni tal-ħjata | Apparat ta' l-istampar u l-grafika | Makkinarju ippakkjar
- Wenzhou
- Ċina
supplyautonomy.com/ntexengineeringworkspvt.in
N-TEX Group focuses on productivity, providing flexible solutions wherever resources, performance and interaction requirements permit. By translating a deep understanding of our customers'... Aqra Aktar »
- Makkinarju tat-tessuti oħra | Apparat ta' l-istampar u l-grafika
- Ahmedabad
- Indja
supplyautonomy.com/xlplastics.in
We are pleased to Introduce ourselves and it would not be out of place to say that we are one of the leading manufacturers of Plastic Film converting machinery in the Asian Sub Continent. We have... Aqra Aktar »
- Bag teħid makkinarju | Apparat ta' l-istampar u l-grafika | Makkinarju ippakkjar
- Vadodara
- Indja
supplyautonomy.com/krishnaengineeringworks6.in
We are pleased to introduce ourselves as one of the leading manufacturers of Plastic Packaging, Paper Converting, Textile Processing Tyre Cord machineries from India. Please visit us at WWW.... Aqra Aktar »
- Apparat sabiex jagħti l-gomma lit-tessuti | Apparat ta' l-istampar u l-grafika | Makkinarju ippakkjar
- Ahmedabad
- Indja
supplyautonomy.com/jayomaindustries.in
JAYOMA INDUSTRIES is Manufacturers and Exporter of Textile Screen Both Of Rotary And Flat screen Machinery and Spares. And Also Manufacturing Flexo Plate making Equipments. JAYOMA is Established in... Aqra Aktar »
- Apparat ta' l-istampar u l-grafika | Basktijiet siment | Tagħmir elettriku u elettroniku
- Ahmedabad
- Indja