نتائج البحث عن: شبكة انترنت خدمات المضيفة

الشركات وجدت 6428


supplyautonomy.com/wiredwebworkcom.us
Founded in June 2010, WiredWebWork.com has been positioned itself as a leading IT provider in the Annapolis, MD area. Focusing on local business and outstanding customer support is setting us ahead... إقرأ المزيد »
  • شبكة انترنت خدمات المضيفة
  • Annapolis
  • الولايات المتحدة
supplyautonomy.com/glowbughosting.us
Glowbug Hosting is a Web Hosting Company offering unlimited FTP accounts,unlimited email accounts,unlimited MySQL database capability. The Glowbug Pr
  • شبكة انترنت خدمات المضيفة
  • Austin
  • الولايات المتحدة
supplyautonomy.com/beenetinternetservices.us
Internet services.
  • شبكة انترنت خدمات المضيفة
  • Exton
  • الولايات المتحدة
supplyautonomy.com/bloomtechservice.us
Thank you for checking out Bloom Tech Services. We are a new company in western Pennsylvania that wants to meet your businesses needs. We are currently offering Surveillance Camera... إقرأ المزيد »
  • شبكة انترنت خدمات المضيفة
  • Mercer
  • الولايات المتحدة
supplyautonomy.com/brandonkrafttechservices.us
Web consulting and hosting for small non-profits and personal use.
  • شبكة انترنت خدمات المضيفة
  • Austin
  • الولايات المتحدة
supplyautonomy.com/buzix.us
We are an internet web hosting company.
  • شبكة انترنت خدمات المضيفة
  • Melbourne
  • الولايات المتحدة
supplyautonomy.com/bydesignnow.us
Having been in the web design business for 12 years put us at advantage! Our hosting is up 99.9 % Prices our fair and customers are #1!
  • شبكة انترنت خدمات المضيفة
  • Puyallup
  • الولايات المتحدة
supplyautonomy.com/canishosting.us
Want to get your personal or business website on the internet? Canis Hosting, Inc. can help. We are a web hosting provider. www.canishosting.com Our mission: Canis Hosting is dedicated to... إقرأ المزيد »
  • شبكة انترنت خدمات المضيفة
  • Northville
  • الولايات المتحدة
supplyautonomy.com/chicagopixels.us
Welcome to the Chicago Pixels Advertising our mission is to bring new momentum in Chicago's advertising industry. Chicago Pixels Advertising has new innovative ideas & concepts that will... إقرأ المزيد »
  • شبكة انترنت خدمات المضيفة
  • Chicago
  • الولايات المتحدة
supplyautonomy.com/cisc.us
CISC, LLC. is your "Creative Internet Solutions Consortium". CISC, LLC. is based in Delaware. For us, it's important to make Website creative. No simple writing scripts but composing a... إقرأ المزيد »
  • شبكة انترنت خدمات المضيفة
  • Wilmington
  • الولايات المتحدة
supplyautonomy.com/cyberoptixnetworks.us
Web Hosting, Domain Registor, and many other domain related services
  • شبكة انترنت خدمات المضيفة
  • Boynton Beach
  • الولايات المتحدة
supplyautonomy.com/digitalboss.us
Leader in Digital Services for companies large and small.
  • شبكة انترنت خدمات المضيفة
  • Panorama City
  • الولايات المتحدة
supplyautonomy.com/digizip.us
Verizon's Wholesale Provider
  • شبكة انترنت خدمات المضيفة
  • Port Chester
  • الولايات المتحدة
supplyautonomy.com/ecowhalecom.us
Internet Website & Graphics Design, Publishing & Marketing | Get a Head Start & Learn More ¿ Domain name consulting, registration & eco (alternative energy powered) hosting ... إقرأ المزيد »
  • شبكة انترنت خدمات المضيفة
  • Loveland
  • الولايات المتحدة
supplyautonomy.com/hostingdonecom.us
When your business is ready to for a professional web-site presentation we will host your pages on our server. When you want to be found in the search engines we can optimize your pages.
  • شبكة انترنت خدمات المضيفة
  • Laplace
  • الولايات المتحدة
supplyautonomy.com/webcomgroup.us
Web.com Group, Inc. is a provider of Do-It-For-Me and Do-It-Yourself Website building tools, online marketing, lead generation, eCommerce, and technology solutions. The Company offers a range of Web... إقرأ المزيد »
  • شبكة انترنت خدمات المضيفة
  • Jacksonville
  • الولايات المتحدة
supplyautonomy.com/yaleassociates.us
Data Hosting
  • شبكة انترنت خدمات المضيفة
  • Diamond Bar
  • الولايات المتحدة
supplyautonomy.com/filemaker.us
  • الجاهزة والبرمجيات | شبكة انترنت خدمات المضيفة
  • Santa Clara
  • الولايات المتحدة
supplyautonomy.com/earnrealcashws.us
  • شبكة انترنت خدمات المضيفة
  • Dover
  • الولايات المتحدة
supplyautonomy.com/doubledogcommunications.us
  • شبكة انترنت خدمات المضيفة | الاتصالات
  • York
  • الولايات المتحدة
supplyautonomy.com/fitnessventuregroup.us
  • وكالات الإعلان | شبكة انترنت خدمات المضيفة
  • Scottsdale
  • الولايات المتحدة
supplyautonomy.com/freshwebdesignz.us
  • شبكة انترنت خدمات المضيفة
  • Fort Wayne
  • الولايات المتحدة
supplyautonomy.com/getjococom.us
  • شبكة انترنت خدمات المضيفة
  • Wailuku
  • الولايات المتحدة
supplyautonomy.com/computerplus.us
  • شبكة انترنت خدمات المضيفة
  • Kerrville
  • الولايات المتحدة
supplyautonomy.com/hostroudycom.us
  • شبكة انترنت خدمات المضيفة
  • Stow
  • الولايات المتحدة
supplyautonomy.com/independentviradyneviralmarketingdirector.us
  • شبكة انترنت خدمات المضيفة
  • Little Rock
  • الولايات المتحدة
supplyautonomy.com/mikestechnicalandsoftware.us
  • شبكة انترنت خدمات المضيفة
  • Auburn
  • الولايات المتحدة
supplyautonomy.com/mountaincomputerwizards.us
  • شبكة انترنت خدمات المضيفة | خدمات اتصالات البيانات
  • Buena Vista
  • الولايات المتحدة
supplyautonomy.com/neoninternet.us
  • رسومات الحاسوب، وخدمة | شبكة انترنت خدمات المضيفة
  • Carbondale
  • الولايات المتحدة
supplyautonomy.com/ovationnetworks.us
  • الاتصال بشبكة الإنترنت، والخدمات | شبكة انترنت خدمات المضيفة
  • Cedar Rapids
  • الولايات المتحدة