Search Results for: Chemical waste - collection and recycling

Found 219 companies


supplyautonomy.com/leeaimportexport.tr
We are traders of carbon and graphite components for submersible motors. We trade carbon bearings, carbon thrust bearings and complete thrust sets (carbon thrust bearing, metal base, and segmented... Read More »
  • Regeneration of catalysts | Regeneration services for activated carbon | Recovery and regeneration of photographic...
  • İstanbul
  • Turkey
supplyautonomy.com/suchetanexportspvt.in
This Group company born on 13th June, 1989 has the distinction of being the biggest player in the Raw cotton / Cotton waste trade. It has its offices at various places in India and has its global... Read More »
  • Machine tow processing services | Textile waste processing services, wool | Textile waste processing services, hair |...
  • Mumbai
  • India
supplyautonomy.com/plasticalgroupsl.es
  • Waste reclamation and disposal consultants | Removal contractors, office | Removal services for factory or workshop...
  • Etxebarri
  • Spain
supplyautonomy.com/tbfenvironmentaltechnology1.ca
TBF Environmental Technology manufactures innovative solvents which reduce the atmospheric emission of VOCs, HAPs and GHGs. TBF\'s non-toxic solvents reduce the health risk to ten million US... Read More »
  • Recovery and regeneration of volatile organic compounds (VOC) | Environmental technology research
  • Surrey
  • Canada
supplyautonomy.com/haldortopsoeeinternationalas.dk
Profil Haldor Topsøe's technologies and catalysts are used around the world creating a better environment - in the refining industry ensuring cleaner fuels, for cleaning power industry flue ... Read More »
  • Regeneration of catalysts | Regeneration services for activated carbon | Recovery and regeneration of photographic...
  • Lyngby
  • Denmark
supplyautonomy.com/nettoyageserigraphie.fr
  • Recovery and refining of industrial oil | Recovery and regeneration of contaminated solvents | Filling and packaging...
  • Saint-Rémy-de-Provence
  • France
supplyautonomy.com/ecosistemspa.it
Eco Sistem works in the waste management and disposal sector, organises the dismantling of industrial and small-scale manufacturing, construction and public institution inventory surpluses. Offers... Read More »
  • Decontamination of industrial waste | Sanitation | Asbestos removal - contractors | Chemical waste - collection and...
  • Rome
  • Italy
supplyautonomy.com/johnsonmattheyfuelcellslimited.gb
Export Johnson Matthey is a speciality chemicals company focussed on its core skills in precious metals, catalysts and fine chemicals. It is organised into three global divisions: Environmental... Read More »
  • Regeneration of catalysts | Regeneration services for activated carbon | Recovery and regeneration of photographic...
  • London
  • United Kingdom
supplyautonomy.com/lassilatikanojaoyj.fi
Company Profile: Lassila & Tikanoja is a service company that is transforming the consumer society into an efficient recycling society. . In co-operation with our customers we are reducing... Read More »
  • Waste reclamation and disposal consultants | Sanitary installations and equipment (hire/rental) | Refuse containers...
  • HELSINKI
  • Finland
supplyautonomy.com/uspnettoyage.fr
  • Leakage detection and location services, pipelines | Clean rooms, turnkey projects | Biofuel plant, turnkey projects |...
  • Arcueil
  • France
supplyautonomy.com/cometamsa.fr
  • Regeneration of catalysts | Regeneration services for activated carbon | Recovery and regeneration of photographic...
  • Courbevoie
  • France
supplyautonomy.com/orcofasas.fr
  • Waste reclamation and disposal consultants | Breakdown recovery services for heavy road vehicles | Refuse containers...
  • Aix-en-Provence
  • France
supplyautonomy.com/seaserviziecologiciambientalisrl.it
Environmental safety. Sea Ambiente operates its own installations and is able to offer environmentally-responsible storage and processing of all type of industrial waste, hazardous and non-hazardous.... Read More »
  • Decontamination of industrial waste | Refuse treatment - companies | Treatment of industrial waste water | Waste...
  • Camerata
  • Italy
supplyautonomy.com/lgobbisrl.it
  • Production services, dietary supplements | Regeneration of catalysts | Regeneration services for activated carbon |...
  • CAMPO LIGURE (GE)
  • Italy
supplyautonomy.com/ibhw2econsultantssa.be
Environmental projects and waste management - Construction cost consultancy - Engineering and construction supervision. Integration in the group VK Engineering - www.vkgroup.be
  • Waste reclamation and disposal consultants | Sanitary installations and equipment (hire/rental) | Skips (hire/rental) |...
  • Lasne
  • Belgium
supplyautonomy.com/greencrosshealthinnovation.in
Green Cross Health Innovation with an objective to provide healthcare solutions, without side effects, launches its brand VitaGreen. The company produces an extensive range of Ayurveda/Herbal... Read More »
  • Recovery and regeneration of volatile organic compounds (VOC) | Pharmaceutical articles | Gastrointestinal healthcare...
  • Mumbai
  • India
supplyautonomy.com/santengineeringcompany.in
Manufacturer & Exporters of Rubber Processing Machines like Mixing Mill, Dispersion Kneader, Rubber Calendars, Extruder Machine, Rubber Bale Cutter, Tyre Building Machine, Rubber Refiner... Read More »
  • Importers-exporters, non-metallic minerals | Buying agents, rubber and plastic | Commodity merchants, natural resins...
  • Ambala City
  • India
supplyautonomy.com/mahavirrefractoriescorporation.in
Manufacturer and Exporters of Stockists of all Types of Refractories High Alumina, Silliminate, Insulation, Acid Proof Brick Castable, Fire Cements and Fire Clay of all Grades Ceramic, Blankets,... Read More »
  • Regeneration of catalysts | Regeneration services for activated carbon | Recovery and regeneration of photographic...
  • Mumbai
  • India
supplyautonomy.com/islandwidemarketingservicespvt.lk
Import & Supply of Industrial Chemicals,Machinery Lab Equipment,Packaging along with the Technological Inputs & Clearing & Forwarding Agents,Export of Coconut based... Read More »
  • Recovery and regeneration of volatile organic compounds (VOC) | Protein purification services | Sieving of liquids for...
  • Rajagiriya
  • Sri Lanka
supplyautonomy.com/developpementbernardplasencia.fr
  • Pharmaceutical production engineering consultants | Biochemical engineering consultants | Regeneration services for...
  • Saint-Priest
  • France
supplyautonomy.com/yittietotekniikkaoy.fi
Company profile: YIT in brief At YIT we build, develop and maintain a good living environment for people in the Nordic countries, Central Europe, Russia and the Baltic countries. We offer solutions... Read More »
  • Waste reclamation and disposal consultants | Geotechnical engineering consultants | Refuse containers (hire/rental) |...
  • Helsinki
  • Finland
supplyautonomy.com/basfautomotivecoatingsservices.fr
  • Engineering - industrial contractors | Equipped offices and industrial premises - services | Children's homes |...
  • Breuil
  • France
supplyautonomy.com/braunschweigerversorgungsagcokg.de
  • Waste reclamation and disposal consultants | Public transport services, railway, city services | Bus and coach...
  • Brunswick
  • Germany
supplyautonomy.com/johnsonmattheybrandenbergerag.ch
  • Jewellery and bijouterie | Regeneration of catalysts | Regeneration services for activated carbon | Recovery and...
  • Zürich
  • Switzerland
supplyautonomy.com/cilajenergias.dk
  • Waste reclamation and disposal consultants | Freight containers and crates (hire/rental) | Refuse containers...
  • Harboøre
  • Denmark
supplyautonomy.com/norskmiljogresirkuleringas.no
  • Regeneration of catalysts | Regeneration services for activated carbon | Recovery and regeneration of photographic...
  • Oslo
  • Norway
supplyautonomy.com/isovatoras.no
  • Regeneration of catalysts | Regeneration services for activated carbon | Recovery and regeneration of photographic...
  • Hokksund
  • Norway
supplyautonomy.com/parkoviplusdoo.hr
  • Waste reclamation and disposal consultants | Landscaping contractors | Refuse containers (hire/rental) | Waste...
  • Rijeka
  • Croatia