Search Results for: Spray drying of chemicals

Found 36 companies


supplyautonomy.com/sofresidengineering.fr
  • Pipework contractors, chemical and nuclear effluent systems | Pipework installation contractors, chemical plant |...
  • Montigny-le-Bretonneux
  • France
supplyautonomy.com/aircontrolsa.es
  • Cooling plant, turnkey projects | Production services, dietary supplements | Blending of pharmaceuticals | Spray drying...
  • San Sebastián
  • Spain
supplyautonomy.com/stridesarcolab.in
Manufacturer, Exporters and Importers of Antibiotics, Cephalophins, Nutracentieah, HIV Rearoviral, Vitamins, Soft Gelatin Capsule, Tablet, Liquid Injection, Dry Powder Injection, Oral Solid Dosage... Read More »
  • Production services, dietary supplements | Blending of pharmaceuticals | Spray drying of pharmaceuticals | Protein...
  • Bengaluru
  • India
supplyautonomy.com/sudarshandhoopp.in
Manufacturers and Exporters of Incense Products like Dhoop, Agarbathi Coils and Cones, Extruded Bambooless Sticks, Incense Sticks, Magical Charcoal Tablets, Pure Natural Agarbatti, Incense Gift Sets... Read More »
  • Production services, dietary supplements | Filling and packaging services, solvents and adhesives, industrial |...
  • New Delhi
  • India
supplyautonomy.com/islandwidemarketingservicespvt.lk
Import & Supply of Industrial Chemicals,Machinery Lab Equipment,Packaging along with the Technological Inputs & Clearing & Forwarding Agents,Export of Coconut based... Read More »
  • Recovery and regeneration of volatile organic compounds (VOC) | Protein purification services | Sieving of liquids for...
  • Rajagiriya
  • Sri Lanka
supplyautonomy.com/developpementbernardplasencia.fr
  • Pharmaceutical production engineering consultants | Biochemical engineering consultants | Regeneration services for...
  • Saint-Priest
  • France
supplyautonomy.com/borgessa.es
  • Grouting, plaster based | Production services, dietary supplements | Commodity merchants, raw rubber and latex |...
  • Reus
  • Spain
supplyautonomy.com/azelisfrance.fr
  • Production services, dietary supplements | Chemicals - import-export | Blending of pharmaceuticals | Spray drying of...
  • Paris
  • France
supplyautonomy.com/ktronfrance.fr
  • Production services, dietary supplements | Filling and packaging services, solvents and adhesives, industrial |...
  • Croissy-sur-Celle
  • France
supplyautonomy.com/hosokawamicronlimited.gb
Hosokawa Micron Ltd is your single source for integrated powder processing systems and containment solutions. Our core products and services include particle design for nano technology, size... Read More »
  • Mixing and blending technology engineering consultants | Production services, dietary supplements | Blending of...
  • Runcorn
  • United Kingdom
supplyautonomy.com/lgobbisrl.it
  • Production services, dietary supplements | Regeneration of catalysts | Regeneration services for activated carbon |...
  • CAMPO LIGURE (GE)
  • Italy
supplyautonomy.com/corquimiaindustrialsl.es
  • Production services, dietary supplements | Importers-exporters, chemicals | Regeneration of catalysts | Regeneration...
  • Esplugues de Llobregat
  • Spain
supplyautonomy.com/nopcopapertechnologysl.es
  • Production services, dietary supplements | Recovery of oils and fats from effluent and waste water | Blending of...
  • Terrassa
  • Spain
supplyautonomy.com/irelspolsro.cz
  • Production services, dietary supplements | Packaging services for the transportation of chemicals | Blending of...
  • Miroslav
  • Czech Republic
supplyautonomy.com/budellifreressnc.fr
  • Spray drying of chemicals | Cages and batteries, fur animal breeding | Hutches, rabbit | Equipment for rabbit breeding...
  • Sorel-Moussel
  • France
supplyautonomy.com/toshniwalsystemsandinstrumentsprivatelimited.in
Manufacturers, Exporters & Importers Of Oval Gear Meter, Turbine Flow Meter, Vortex Meter, Density Meter, Cone Meter, Clamp On Ultrasonic Meter, Magnetic Inductive Flow Sensor, Flow Computer,... Read More »
  • Production services, dietary supplements | Blending of pharmaceuticals | Spray drying of pharmaceuticals | Protein...
  • Chennai
  • India
supplyautonomy.com/foodbiotechengineersipvt.in
Manufacturers And Exporters Of Dairy and Food Processing Machinery and Equipment.
  • Spray drying of pharmaceuticals | Drying of chemical products | Spray drying of chemicals | Freeze drying of chemicals...
  • Faridabad
  • India
supplyautonomy.com/ajantachemicals.in
Manufacturers and Exporters of Agro Chemicals, Organic Chemicals and Inorganic Chemicals.
  • Production services, dietary supplements | Blending of pharmaceuticals | Spray drying of pharmaceuticals | Protein...
  • New Delhi
  • India
supplyautonomy.com/przedstswicielstwoallgaiermogensenswieslawstrobinallgaiermogensen.pl
  • Spray drying services for the food industry | Industrial equipment hire | Spray drying of pharmaceuticals | Drying of...
  • Lodz
  • Poland
supplyautonomy.com/alchimexsa.ro
  • Production services, dietary supplements | Blending of pharmaceuticals | Spray drying of pharmaceuticals | Protein...
  • Bucharest
  • Romania
supplyautonomy.com/lessonia.fr
  • Production services, dietary supplements | Recovery and refining of industrial oil | Recovery and regeneration of...
  • ST THONAN
  • France
supplyautonomy.com/ikpindustrikemiproduktionviaredab.se
  • Production services, dietary supplements | Blending of pharmaceuticals | Spray drying of pharmaceuticals | Protein...
  • Hovås
  • Sweden
supplyautonomy.com/marinaprodprestsrl.ro
  • Spray drying of chemicals | Concrete and mortar accelerators/hardeners | Concrete and mortar retardants | Concrete and...
  • Galati
  • Romania
supplyautonomy.com/alliancechimiealgeriespa.dz
  • Production services, dietary supplements | General brokers, international trade | Transit traders | Importers with...
  • Rouiba
  • Algeria
supplyautonomy.com/muronorthamericainc.ca
Metro North America Inc, designed to drive 150 screws of Coil or 30 screws of Strip automatically.
  • Spray drying services for the food industry | Cleaning services, marine tank | Maintenance and cleaning contractors for...
  • Brampton
  • Canada
supplyautonomy.com/solidesdivisestechnologiessdtechsa1.fr
  • Granulating services for chemical products | Grinding of chemical products | Drying of chemical products | Spray drying...
  • Alès
  • France
supplyautonomy.com/jyotidyechemagency.in
We Jyoti Dye-Chem are known for providing effective and highly efficient agricultural minerals and chemicals. At present we are engaged in the exporting of Manganese Oxide, Cobalt Sulphate,... Read More »
  • Spray drying of pharmaceuticals | Spray drying of chemicals | Freeze drying of chemicals | Corn gluten meal
  • Mumbai
  • India
supplyautonomy.com/powerpacengineers.in
Manufacturer of Spray dryer, Flash & Spin Flash Dryer, Fluid Bed Dryer, Granulator, incinerator, Coating machine, Pharmaceutical & Chemical Machineries and Industrial Heating Systems.
  • Spray drying of pharmaceuticals | Spray drying of chemicals | Freeze drying of chemicals | Powder coatings, plastic...
  • Ahmedabad
  • India