תוצאות חיפוש עבור: שירותי טיהור חלבונים
חברות 35 נמצאורישומים הקשורים לבכורה: שירותי טיהור חלבונים
supplyautonomy.com/librawpharma.in
Manufacturers and Exporters Of Pharmaceutical Products Like Tablets Including Polyoxyl 40 Hydrogenated Castor Oil, Solvent Enteric Coating Polymer, Lake Colours Aqueous Enteric Coating Polymers,... קראו עוד »
- ערבוב של תרופות | ספריי ייבוש של תרופות | שירותי טיהור חלבונים | שאיבה וטיהור של הורמוני אדם | ערבוב ומיזוג של משחות עבו...
- New Delhi
- הודו
supplyautonomy.com/hrsprocesssystems.in
Manufacturers, Exporters & Importers Of Wide Range Of Heat Exchangers, ECOFLUX* Corrugated Tube Heat Exchanger, Shell And Tube Heat Exchanger, UNICUS® Scraped Surface Heat Exchanger, ... קראו עוד »
- שירותי ייצור, תוספי מזון | ערבוב של תרופות | ספריי ייבוש של תרופות | שירותי טיהור חלבונים | שאיבה וטיהור של הורמוני אדם ...
- Pune
- הודו
supplyautonomy.com/univar.fr
- כימיקלים - יבוא ויצוא | שירותי טיהור חלבונים | סינון של משחות עבור התעשייה הכימית | סיווג שירותי אוויר לתעשייה הכימי | C...
- Fontenay-sous-Bois
- צרפת
supplyautonomy.com/kellyservices.fr
- יועצים מטאורולוגיים | יועצי כוח קיטור | יועצי גיאופיסיקה | יועצי hydrogeology | יועצי פיתוח תהום | יועצים גנטיים ביוטכנו...
- Clichy
- צרפת
supplyautonomy.com/sofresidengineering.fr
- קבלני צנרת, כימי ומערכות שפכים גרעיניות | קבלני התקנת צינורות, מפעל כימי | קבלני צנרת התקנה, תנורים ודודים | קבלני התקנת...
- Montigny-le-Bretonneux
- צרפת
supplyautonomy.com/sudarshandhoopp.in
Manufacturers and Exporters of Incense Products like Dhoop, Agarbathi Coils and Cones, Extruded Bambooless Sticks, Incense Sticks, Magical Charcoal Tablets, Pure Natural Agarbatti, Incense Gift Sets... קראו עוד »
- שירותי ייצור, תוספי מזון | מילוי ושירותים אריזה, ממסים ודבקים, תעשייתיים | ערבוב של תרופות | ספריי ייבוש של תרופות | שיר...
- New Delhi
- הודו
supplyautonomy.com/stridesarcolab.in
Manufacturer, Exporters and Importers of Antibiotics, Cephalophins, Nutracentieah, HIV Rearoviral, Vitamins, Soft Gelatin Capsule, Tablet, Liquid Injection, Dry Powder Injection, Oral Solid Dosage... קראו עוד »
- שירותי ייצור, תוספי מזון | ערבוב של תרופות | ספריי ייבוש של תרופות | שירותי טיהור חלבונים | שאיבה וטיהור של הורמוני אדם ...
- Bengaluru
- הודו
supplyautonomy.com/lgobbisrl.it
- שירותי ייצור, תוספי מזון | התחדשות של זרזים | שירותי התחדשות לפחם פעיל | התאוששות והתחדשות של כימיקלים צילום | שחזור וזי...
- CAMPO LIGURE (GE)
- איטליה
supplyautonomy.com/islandwidemarketingservicespvt.lk
Import & Supply of Industrial Chemicals,Machinery Lab Equipment,Packaging along with the Technological Inputs & Clearing & Forwarding Agents,Export of Coconut based... קראו עוד »
- התאוששות והתחדשות של תרכובות אורגניות נדיפות (VOC) | שירותי טיהור חלבונים | סינון של נוזלים לתעשייה הכימי | סינון של משח...
- Rajagiriya
- סרי לנקה
supplyautonomy.com/developpementbernardplasencia.fr
- יועצים הנדסי ייצור תרופות | יועצי הנדסה ביוכימית | שירותי התחדשות לפחם פעיל | התאוששות והתחדשות של תרכובות אורגניות נדיפ...
- Saint-Priest
- צרפת
supplyautonomy.com/aircontrolsa.es
- מפעל קירור, פרויקטי סוהר | שירותי ייצור, תוספי מזון | ערבוב של תרופות | ספריי ייבוש של תרופות | שירותי טיהור חלבונים | ש...
- San Sebastián
- ספרד
supplyautonomy.com/borgessa.es
- בהתבסס דיוס, טיח | שירותי ייצור, תוספי מזון | סוחרי סחורות, גומי גולמי ולטקס | סוחרי סחורות, נפט גולמי | ערבוב של תרופות...
- Reus
- ספרד
supplyautonomy.com/azelisfrance.fr
- שירותי ייצור, תוספי מזון | כימיקלים - יבוא ויצוא | ערבוב של תרופות | ספריי ייבוש של תרופות | שירותי טיהור חלבונים | שאיב...
- Paris
- צרפת
supplyautonomy.com/ktronfrance.fr
- שירותי ייצור, תוספי מזון | מילוי ושירותים אריזה, ממסים ודבקים, תעשייתיים | ערבוב של תרופות | ספריי ייבוש של תרופות | שיר...
- Croissy-sur-Celle
- צרפת
supplyautonomy.com/hosokawamicronlimited.gb
Hosokawa Micron Ltd is your single source for integrated powder processing systems and containment solutions. Our core products and services include particle design for nano technology, size... קראו עוד »
- ערבוב ומיזוג יועצי הנדסה וטכנולוגיה | שירותי ייצור, תוספי מזון | ערבוב של תרופות | ספריי ייבוש של תרופות | שירותי טיהור ...
- Runcorn
- בריטניה
supplyautonomy.com/irelspolsro.cz
- שירותי ייצור, תוספי מזון | שירותי אריזה להובלת כימיקלים | ערבוב של תרופות | ספריי ייבוש של תרופות | שירותי טיהור חלבונים...
- Miroslav
- צ׳כיה
supplyautonomy.com/corquimiaindustrialsl.es
- שירותי ייצור, תוספי מזון | יבואנים-יצואנים, כימיקלים | התחדשות של זרזים | שירותי התחדשות לפחם פעיל | התאוששות והתחדשות ש...
- Esplugues de Llobregat
- ספרד
supplyautonomy.com/nopcopapertechnologysl.es
- שירותי ייצור, תוספי מזון | שחזור של שמנים ושומנים ממים בשפכים ופסולת | ערבוב של תרופות | ספריי ייבוש של תרופות | שירותי ...
- Terrassa
- ספרד
supplyautonomy.com/ajantachemicals.in
Manufacturers and Exporters of Agro Chemicals, Organic Chemicals and Inorganic Chemicals.
- שירותי ייצור, תוספי מזון | ערבוב של תרופות | ספריי ייבוש של תרופות | שירותי טיהור חלבונים | שאיבה וטיהור של הורמוני אדם ...
- New Delhi
- הודו
supplyautonomy.com/toshniwalsystemsandinstrumentsprivatelimited.in
Manufacturers, Exporters & Importers Of Oval Gear Meter, Turbine Flow Meter, Vortex Meter, Density Meter, Cone Meter, Clamp On Ultrasonic Meter, Magnetic Inductive Flow Sensor, Flow Computer,... קראו עוד »
- שירותי ייצור, תוספי מזון | ערבוב של תרופות | ספריי ייבוש של תרופות | שירותי טיהור חלבונים | שאיבה וטיהור של הורמוני אדם ...
- Chennai
- הודו
supplyautonomy.com/alchimexsa.ro
- שירותי ייצור, תוספי מזון | ערבוב של תרופות | ספריי ייבוש של תרופות | שירותי טיהור חלבונים | שאיבה וטיהור של הורמוני אדם ...
- Bucharest
- רומניה
supplyautonomy.com/lessonia.fr
- שירותי ייצור, תוספי מזון | שחזור וזיקוק נפט תעשייתי | התאוששות והתחדשות של ממסים מזוהמים | ערבוב של תרופות | ספריי ייבוש...
- ST THONAN
- צרפת
supplyautonomy.com/ikpindustrikemiproduktionviaredab.se
- שירותי ייצור, תוספי מזון | ערבוב של תרופות | ספריי ייבוש של תרופות | שירותי טיהור חלבונים | שאיבה וטיהור של הורמוני אדם ...
- Hovås
- שוודיה
supplyautonomy.com/alliancechimiealgeriespa.dz
- שירותי ייצור, תוספי מזון | ברוקרים כלליים, סחר בינלאומי | סוחרי מעברות | יבואנים עם ייצוגים של היצרנים | יבואנים-יצואנים...
- Rouiba
- אלג׳יריה
supplyautonomy.com/lafayettehill.us
Protica Inc. is a nutritional research firm specializing in the development of capsulized foods (dense nutrition in compact liquid and food forms). Protica manufactures Profect, IsoMetric, Pediagro,... קראו עוד »
- שירותי טיהור חלבונים | חלבון
- Whitehall
- ארצות הברית
supplyautonomy.com/protagenag.de
Protagen AG offers a growing number of products and services based on the unique expertise in antibody characterization, high throughput expression, purification of recombinant proteins
- שירותי טיהור חלבונים | יוטכנולוגיות
- Dortmund
- גרמניה
supplyautonomy.com/gremountinternational.cn
Mainly exports food additives, feed additives, flavours, sweeteners, nutrition, organic chemicals, amino acid, plant extracts, medicine intermediates and chemicals for water treatment. import whey... קראו עוד »
- שירותי טיהור חלבונים | סיווג שירותי אוויר לתעשייה הכימי | Calcining של כימיקלים | הלבנת שירותים לתעשייה הכימית...
- Beijing
- סין
supplyautonomy.com/nzymebiotecgmbh.de
- שירותי טיהור חלבונים | יוטכנולוגיות
- Darmstadt
- גרמניה
supplyautonomy.com/gnc1.us
supplyautonomy.com/thefreshmonkeecolchester.us
Whether you're looking for a nutritious post-workout boost or a tasty treat, our popular shakes like the Antioxidant Berry, Mint Oreo, Mass Strawberry Oats, Maui Colada, and Banana Split are... קראו עוד »
- שירותי טיהור חלבונים | מזונות דיאטטיים, טיפולים, לתזונה
- Colchester
- ארצות הברית