Leitarniðurstöður fyrir: Sólarorku framleiðslu
Fundust 156 fyrirtækiPreferred skráningar tengdar: Sólarorku framleiðslu
supplyautonomy.com/sandielectricco.cn
Yueqing Sandi Electric Co., Ltd is an international PV enterprise which is located in the "capital of China's electrical appliances" Wenzhou. Specialized in the new energy source and... Lesa meira »
- Sól | Sólarorku framleiðslu | Vindorka - framleiðsla | Neyðarnúmer máttur kerfi | Spenna eftirlitsstofnunum / varðve...
- Yueqing
- Kína
supplyautonomy.com/energiatotal.br
Energia Total has dozens of Photovoltaic Solar Energy projects executed and in operation throughout Mato Grosso, both connected to the Concessionaire Grid (GridTie) in the Distributed Micro... Lesa meira »
- Sól safnara, uppsetningu | Sól spjaldið þak-nær vinna | Sól | Sólarorku framleiðslu | Sól ráðgjafar orku | Sólarorku - i...
- Cuiabá
- Brasilía
supplyautonomy.com/crosspolimerispa.it
Special, thermoplastic and cross-linkable compounds that are fire retardant and halogen free. Special polymers for reactive processes. Elastic components resistant to wear, climate conditions,... Lesa meira »
- Rafmagnsframleiðsla | Sólarorku framleiðslu | Cold vals köflum | Snið af non-málmum | Snið málmum | Plastics - iðnaðar h...
- Sala Baganza
- Ítalía
supplyautonomy.com/devamsolar.au
At Devam Solar, we're dedicated to revolutionizing the way you harness energy. As a top provider of solar solutions, we enable homeowners and businesses nationwide to adopt sustainable, clean... Lesa meira »
- Sól safnara, uppsetningu | Sól spjaldið þak-nær vinna | Sól virkjanir með ljósmynd rafmagns mótor frumur | Sól | Sólaror...
- Truganina
- Ástralía
supplyautonomy.com/solarsmart.in
Solar Smart is the Best Solar Company in Ahmedabad, Gujarat. Get APS, Tata & Adani Solar Penal at an affordable price for your home - Solar Rooftop System Provider in Ahmedabad. We provide... Lesa meira »
- Sól safnara, uppsetningu | Sól spjaldið þak-nær vinna | Sól | Sólarorku framleiðslu | Sól ráðgjafar orku | Sól uppsetnin...
- Ahmedabad
- Indland
supplyautonomy.com/7f682bfa5387c20b86058eb9a5f8e8cca6afe7ac.us
Welcome to Solar4les, where passion meets purpose in the realm of solar energy solutions. Founded by Les Lovett, a visionary with a background in the mortgage industry, Solar4les represents a... Lesa meira »
- Rafmagnsframleiðsla | Sól virkjanir með ljósmynd rafmagns mótor frumur | Endurnýjanleg orka | Sól | Sólarorku framlei...
- Queen Creek
- Bandaríkin
supplyautonomy.com/teravasdnbhd.my
Tera Va Sdn Bhd was founded in 2011 when Malaysia's solar industry was just starting, and since then, our company has become a major player in the renewable solar energy sector. As a registered... Lesa meira »
- Sól | Sólarorku framleiðslu | Sólarplötur | Sólkerfum orku og búnaður | Inverters fyrir sól frumur | Sólkerfum máttur, e...
- Petaling Jaya
- Malasía
supplyautonomy.com/solarconnectaustintexas.us
Solar Connect Austin is the premier solar company in the city of Austin Texas. Our goal is to empower residents and businesses in Austin, Texas by giving them control over their energy consumption... Lesa meira »
- Sól spjaldið þak-nær vinna | Sól | Sólarorku framleiðslu | Sól ráðgjafar orku | Sól og endurnýjanlega orku | Sólarorku -...
- Austin
- Bandaríkin
supplyautonomy.com/aqsolarengineering.pk
"AQ Solar Engineering in okara is all-in-one solution for solar energy solutions for eco-friendly environment. Our preliminary products include solar panels, inverters, AC/DC breaker, dc wires,... Lesa meira »
- Uppsetning verk, fyrir rafmagns iðnaður | Endurnýjanleg orka | Sól | Sólarorku framleiðslu | Endurnýjanlegir orkugjafar ...
- Okara
- Pakistan
supplyautonomy.com/sssouthlakesolar.us
Southlake Solar Installation, a trusted name in the solar industry, offers the highest-quality solar system installations in the Southlake area. Committed to customer satisfaction, our team uses the... Lesa meira »
- Endurnýjanleg orka | Sól | Sólarorku framleiðslu | Sól frumur, sól spjaldið | Sólarplötur | Solcelletak, köflum | Photo ...
- Southlake
- Bandaríkin
supplyautonomy.com/powerfullygreen.us
At Powerfully Green, your solar experience is our top priority. We bring a local focus backed by 10 years of knowledge and experience, and we pride ourselves on acting as a community-minded solar... Lesa meira »
- Sólarorku framleiðslu | Sól ráðgjafar orku | Sólarorku búnað | Sólarplötur
- St Paul
- Bandaríkin
supplyautonomy.com/azurepower.in
With an aim to become the lowest-cost power producer in the world, Azure power – a Solar Power Company – is on its way to power the world at a reduced cost. They are already selling solar power in Ind... Lesa meira »
- Sól safnara, uppsetningu | Sól spjaldið þak-nær vinna | Endurnýjanleg orka rannsóknir | Sól virkjanir með ljósmynd rafma...
- Delhi
- Indland
supplyautonomy.com/powercomsolar.au
supplyautonomy.com/bluebirdsolar.in
Bluebird Solar is one of India’s leading solar panel manufacturers with the mission to deliver sophisticated solar power solutions to our customers. Backed by Bluebird Stabilisers we are a reputed b... Lesa meira »
- Sólarorku framleiðslu | Sól frumur, sól spjaldið
- Delhi
- Indland
supplyautonomy.com/electropalomo.es
supplyautonomy.com/dosolarco.cn
Do Solar Co. Ltd is a leading Chinese manufacturer of a variety of solar modules ranging from 5W to 300W. Established in 2008 in response to an acknowledgement of the growing transition towards... Lesa meira »
- Sólarorku framleiðslu | Rafmagns íhlutum | Rafbúnað og rafeindabúnað | Sól frumur, sól spjaldið | Sól vörur og tæki...
- Jinhua
- Kína
supplyautonomy.com/magsolarwinnipeg.ca
supplyautonomy.com/phocosamericasinc.us
The Phocos Any-GridTM PSW-H Inverter Charger Series (Pure Sine Wave Hybrid) represents Phocos’ most versatile line of inverters/chargers. Flexibility and reliability are key characteristics of this p... Lesa meira »
- Endurnýjanleg orka | Sól | Sólarorku framleiðslu | Endurnýjanlegir orkugjafar | Orka sparnaður & orku stjórnun
- Tucson
- Bandaríkin
supplyautonomy.com/expertsolarpros.us
supplyautonomy.com/pickrenewenergypvt.in
Solar Company in Madhya Pradesh, Solar Company in Indore, Best Solar Company in India, Best Solar Company in Indore, Best Solar Company in Madhya Pradesh, Rooftop solar for home, Rooftop solar for... Lesa meira »
- Sól safnara, uppsetningu | Sól spjaldið þak-nær vinna | Sólarorku framleiðslu | Sól ráðgjafar orku | Endurnýjanlegir ork...
- Indore
- Indland
supplyautonomy.com/suvastikasystemsprivatelimited.in
We are in inverter, UPS and solar products along with the lithium battery. Lift inverters etc Pls let me know what all you need and once we get results we will be your permanent customer.Su-Vastika... Lesa meira »
- Sólarorku framleiðslu | Sól ráðgjafar orku | Lithium rafgeymar | Sól vörur og tæki | Sólarorku búnað, framleiðen...
- Gurgaon
- Indland
supplyautonomy.com/greenreliance.au
Green Reliance is an Australian Solar Installation company that is CEC accredited and provides high quality systems at reasonable prices.Want to use renewable energy to lessen your electricity... Lesa meira »
- Sól | Sólarorku framleiðslu | Sól ráðgjafar orku | Sólarorku - innsetningar | Sólarorku búnað | Sól uppsetningu | Sólaro...
- Wayville
- Ástralía
supplyautonomy.com/macedonrangessolarpower.au
Macedon Ranges can create a solar power system designed for your electric power consumption in your home or business. As a company, we believe in offering our clients a solid and direct pathway to... Lesa meira »
- Sól safnara, uppsetningu | Sól | Sólarorku framleiðslu | Sól og endurnýjanlega orku | Sólarorku - innsetningar | Sól fru...
- New Gisborne
- Ástralía
supplyautonomy.com/qingdaotaidanewenergyco.cn
Qingdao Taida New Energy Co., Ltd. is a leading manufacturer of solar powered products in China. With more than five years of solar powered product manufacturing experience, we specialize in the... Lesa meira »
- Sólarorku framleiðslu | Rafmagns íhlutum | Sól frumur, sól spjaldið | Glóperur | Sól vörur og tæki
- Qingdao
- Kína
supplyautonomy.com/zhejiangraileysolarenergyproducts.cn
Established in 1999, Zhejiang Railey Solar Energy Co., Ltd. is a professional enterprise in solar application technique research, manufacture and market promotion, with Rili as our brand. We are one... Lesa meira »
- Sólarorku framleiðslu | Sól safnara | Sól vörur og tæki
- Shangyu
- Kína
supplyautonomy.com/northhighlandssolarpanelcleaning.us
# 1 Concrete Solar Panel Cleaning Company in North Highlands CA and the surrounding areas in Sacramento County. Call us today for a free estimate! Or visit us on our website for more details about... Lesa meira »
- Sól safnara, uppsetningu | Sól spjaldið þak-nær vinna | Sólarorku framleiðslu | Þétta, fasta, fyrir spara orku | Rafverk...
- North highlands
- Bandaríkin
supplyautonomy.com/jgsolarsolutions.us
JG Solar Solutions is dedicated to providing top-tier solar energy solutions for residential and commercial clients. Our expert team designs and installs efficient, cost-effective solar systems that... Lesa meira »
- Sólarorku framleiðslu
- Midlothian
- Bandaríkin
supplyautonomy.com/australiansolardesigns.au
Australian Solar Designs Pty Ltd (ASD) was established in 2009 and is run by a team of industry professionals with vast solar experience and a passion for contributing to Australia’s Clean Energy F... Lesa meira »
- Sól safnara, uppsetningu | Sól spjaldið þak-nær vinna | Sól virkjanir með ljósmynd rafmagns mótor frumur | Sól | Sólaror...
- Alexandria
- Ástralía
supplyautonomy.com/customizedsolarsolutions2.us
We offer a comprehensive approach to solar energy that ensures peace of mind and longevity. Our 25-year warranty on the entire system covers all aspects, including the micro-inverter, panels, wiring,... Lesa meira »
- Sól safnara, uppsetningu | Sólarorku framleiðslu | Sól ráðgjafar orku | Sólarorku búnað, framleiðendur | Sólarorku búnað...
- Port St. Lucie
- Bandaríkin