Loading...
에 대한 검색 결과 : 재활용 및 복구 자료, 서비스
발견 7483 회사supplyautonomy.com/1stchoiceskips.gb
Skip Hire in Canterbury
1st choice skips has a large selection of 4 yard and 6 yard skips for you to hire at your convenience.
4 yard and 6 yard skips.
Keywords: skips, 4 yard skips, 6 yard... 자세히보기 »
- 쓰레기 수거 서비스 | 수거 서비스를 거부 | 유해 폐기물의 수집 | 병원 및 실험실 폐기물 수집 및 처리 | 쓰레기 - 교통 서비스 | 국내 폐기물 수집 및 처리 | 폐기물 수집, 처리 및 처분 활동, 자료 복구 ...
- Canterbury
- 영국
supplyautonomy.com/allwasteskiphire.gb
Skip Hire in Stockport
Family Run , Reliable, Mini, Midi, Maxi Skips Available Call For a free Quote.
We are a family run business operating in and around the Greater Manchester area. We offer a... 자세히보기 »
- 쓰레기 수거 서비스 | 수거 서비스를 거부 | 유해 폐기물의 수집 | 병원 및 실험실 폐기물 수집 및 처리 | 쓰레기 - 교통 서비스 | 국내 폐기물 수집 및 처리 | 폐기물 수집, 처리 및 처분 활동, 자료 복구 ...
- Stockport
- 영국
supplyautonomy.com/jasskiphire.gb
Skip Hire in Leigh
Reliable Skip Hire 6 days a week, Waste Disposal, Scrap Metal Dealer, Scrap Car Recycling, Buyer of Ferrous and Non Ferrous Metals, Car & Commercial Batteries, Catalytic... 자세히보기 »
- 쓰레기 수거 서비스 | 수거 서비스를 거부 | 유해 폐기물의 수집 | 병원 및 실험실 폐기물 수집 및 처리 | 쓰레기 - 교통 서비스 | 국내 폐기물 수집 및 처리 | 폐기물 수집, 처리 및 처분 활동, 자료 복구 ...
- Leigh
- 영국
supplyautonomy.com/skiphiregateshead.gb
Skip Hire in Gateshead
Skip Hire Gateshead is a family ran business specialising in skip hire in the town of Gateshead
2010
Keywords: skip hire company, rubbish clearance, rubbish... 자세히보기 »
- 쓰레기 수거 서비스 | 수거 서비스를 거부 | 유해 폐기물의 수집 | 병원 및 실험실 폐기물 수집 및 처리 | 쓰레기 - 교통 서비스 | 국내 폐기물 수집 및 처리 | 폐기물 수집, 처리 및 처분 활동, 자료 복구 ...
- Gateshead
- 영국
supplyautonomy.com/feelyskipgrabhireltd.gb
Builders Merchants in Surbiton
Feely Skip & Grab Hire Ltd is your Skip & Grab Hire Company in Surbiton, London. We can deliver a digger, dump truck, or JCB to your site in one hour. You can... 자세히보기 »
- 쓰레기 수거 서비스 | 수거 서비스를 거부 | 유해 폐기물의 수집 | 병원 및 실험실 폐기물 수집 및 처리 | 쓰레기 - 교통 서비스 | 국내 폐기물 수집 및 처리 | 폐기물 수집, 처리 및 처분 활동, 자료 복구 ...
- Surbiton
- 영국
supplyautonomy.com/thewasteguys.gb
Skip Hire in Nottingham
The Waste Guys in Nottingham are specialists in House and Rubbish Clearance - Domestic Junk Removal - Office Clearance and Removal and Commercial Waste Disposal.
The Waste... 자세히보기 »
- 쓰레기 수거 서비스 | 수거 서비스를 거부 | 유해 폐기물의 수집 | 병원 및 실험실 폐기물 수집 및 처리 | 쓰레기 - 교통 서비스 | 국내 폐기물 수집 및 처리 | 폐기물 수집, 처리 및 처분 활동, 자료 복구 ...
- Nottingham
- 영국
supplyautonomy.com/chelmsfordskiphire.gb
Skip Hire in Chelmsford
Canvey skip hire offers professional skip hire services at most competitive prices in canvey. Whether you are a residential customer wanting some skips for house/garden... 자세히보기 »
- 쓰레기 수거 서비스 | 수거 서비스를 거부 | 유해 폐기물의 수집 | 병원 및 실험실 폐기물 수집 및 처리 | 쓰레기 - 교통 서비스 | 국내 폐기물 수집 및 처리 | 폐기물 수집, 처리 및 처분 활동, 자료 복구 ...
- Chelmsford
- 영국
supplyautonomy.com/wycombetradewasteskiphireltd.gb
Skip Hire in Princes Risborough
Wycombe trade waste & Skip Hire offer good value skips from 2-20yrd skips across high wycombe aylesbury amersham and other HP postcode areas we also offer... 자세히보기 »
- 쓰레기 수거 서비스 | 수거 서비스를 거부 | 유해 폐기물의 수집 | 병원 및 실험실 폐기물 수집 및 처리 | 쓰레기 - 교통 서비스 | 국내 폐기물 수집 및 처리 | 폐기물 수집, 처리 및 처분 활동, 자료 복구 ...
- Princes Risborough
- 영국
supplyautonomy.com/hardingskiphire.gb
Tool Hire Services in Romford
Skip hire - skips - 2yrd - 4yrd - 6yrd - Dagenham Romford Rush green Ilford Hornchurch Upminster
- 쓰레기 수거 서비스 | 수거 서비스를 거부 | 유해 폐기물의 수집 | 병원 및 실험실 폐기물 수집 및 처리 | 쓰레기 - 교통 서비스 | 국내 폐기물 수집 및 처리 | 폐기물 수집, 처리 및 처분 활동, 자료 복구 ...
- ROMFORD
- 영국
supplyautonomy.com/a1supaskipsltd.gb
Skip Hire in Lancaster
A1 Supaskips, is Lancasters No 1 Skip Hire and Waste Recycler . Covering Lancaster, Morecambe, Heysham, Kendal, South lakes, Ingleton, Bentham, Kirkby, Wray Hornby, and... 자세히보기 »
- 쓰레기 수거 서비스 | 수거 서비스를 거부 | 유해 폐기물의 수집 | 병원 및 실험실 폐기물 수집 및 처리 | 쓰레기 - 교통 서비스 | 국내 폐기물 수집 및 처리 | 폐기물 수집, 처리 및 처분 활동, 자료 복구 ...
- Lancaster
- 영국
supplyautonomy.com/reliableskips.gb
Skip Hire in Mitcham
Reliable Family run skip hire company with competitive rates. Please call for further information ...
2006
Keywords: skips, skip hire, skip rental, rubbish skips, rent a... 자세히보기 »
- 쓰레기 수거 서비스 | 수거 서비스를 거부 | 유해 폐기물의 수집 | 병원 및 실험실 폐기물 수집 및 처리 | 쓰레기 - 교통 서비스 | 국내 폐기물 수집 및 처리 | 폐기물 수집, 처리 및 처분 활동, 자료 복구 ...
- Mitcham
- 영국
supplyautonomy.com/barneybags.gb
Skip Hire in Portsmouth
We supply the DIY'er and Professional tradespeople with the ultimate bulk bag for removal of waste! BarneyBags are available in the PO postal codes, Skips are now... 자세히보기 »
- 쓰레기 수거 서비스 | 수거 서비스를 거부 | 유해 폐기물의 수집 | 병원 및 실험실 폐기물 수집 및 처리 | 쓰레기 - 교통 서비스 | 국내 폐기물 수집 및 처리 | 폐기물 수집, 처리 및 처분 활동, 자료 복구 ...
- Portsmouth
- 영국
supplyautonomy.com/davidbrownskips.gb
Skip Hire in Harlow
David Brown Skip Hire is a family-run company providing skip hire waste bin hire and waste disposal and recycling services to a large customer base in Essex and Hertfordshire.... 자세히보기 »
- 쓰레기 수거 서비스 | 수거 서비스를 거부 | 유해 폐기물의 수집 | 병원 및 실험실 폐기물 수집 및 처리 | 쓰레기 - 교통 서비스 | 국내 폐기물 수집 및 처리 | 폐기물 수집, 처리 및 처분 활동, 자료 복구 ...
- River Way
- 영국
supplyautonomy.com/vikingskips.gb
Skip Hire in Walsall
provide a prompt and efficient skip delivery service to the public and trade sector, from mini's to maxi's at very compatable prices. For more imformation visit our... 자세히보기 »
- 쓰레기 수거 서비스 | 수거 서비스를 거부 | 유해 폐기물의 수집 | 병원 및 실험실 폐기물 수집 및 처리 | 쓰레기 - 교통 서비스 | 국내 폐기물 수집 및 처리 | 폐기물 수집, 처리 및 처분 활동, 자료 복구 ...
- Walsall
- 영국
supplyautonomy.com/wastemasters.gb
Skip Hire in Bolton
North West based Wastemasters provide rubbish removal and office and house clearance services. Loading and taking away all forms of junk the fully insured, friendly, uniformed... 자세히보기 »
- 쓰레기 수거 서비스 | 수거 서비스를 거부 | 유해 폐기물의 수집 | 병원 및 실험실 폐기물 수집 및 처리 | 쓰레기 - 교통 서비스 | 국내 폐기물 수집 및 처리 | 폐기물 수집, 처리 및 처분 활동, 자료 복구 ...
- Bolton
- 영국
supplyautonomy.com/skiphirecoventry.gb
- 쓰레기 수거 서비스 | 수거 서비스를 거부 | 유해 폐기물의 수집 | 병원 및 실험실 폐기물 수집 및 처리 | 쓰레기 - 교통 서비스 | 국내 폐기물 수집 및 처리 | 폐기물 수집, 처리 및 처분 활동, 자료 복구 ...
- Coventry
- 영국
supplyautonomy.com/edinburghskiphire.gb
Skip Hire in Edinburgh
We make customer service our number one priority with 44 years of family experience in the business. Since we were established in 1984 we have gained an enviable reputation... 자세히보기 »
- 쓰레기 수거 서비스 | 수거 서비스를 거부 | 유해 폐기물의 수집 | 병원 및 실험실 폐기물 수집 및 처리 | 쓰레기 - 교통 서비스 | 국내 폐기물 수집 및 처리 | 폐기물 수집, 처리 및 처분 활동, 자료 복구 ...
- Edinburgh
- 영국
supplyautonomy.com/kartawayskiphire.gb
Skip Hire in Chelmsford
Waste Management Services, Extensive In-House Recycling, Asbestos & Hazardous Waste Disposal, Large Roll-On Roll-Off Skips, Site Clearance, Wait and Load, House... 자세히보기 »
- 쓰레기 수거 서비스 | 수거 서비스를 거부 | 유해 폐기물의 수집 | 병원 및 실험실 폐기물 수집 및 처리 | 쓰레기 - 교통 서비스 | 국내 폐기물 수집 및 처리 | 폐기물 수집, 처리 및 처분 활동, 자료 복구 ...
- Chelmsford
- 영국
supplyautonomy.com/tomtoondaughtersskiphire.gb
Skip Hire in Coalville
Keywords: waste disposal, Skiphire, skips, cheap skip hire, hire a skip, waste management
- 쓰레기 수거 서비스 | 수거 서비스를 거부 | 유해 폐기물의 수집 | 병원 및 실험실 폐기물 수집 및 처리 | 쓰레기 - 교통 서비스 | 국내 폐기물 수집 및 처리 | 폐기물 수집, 처리 및 처분 활동, 자료 복구 ...
- Coalville
- 영국
supplyautonomy.com/smithsskips.gb
Skip Hire in Sutton-in-Ashfield
We are a Skip Hire company serving the Nottinghamshire area. We offer Skip Hire services to the trade & public. Mini, Midi & Builders skips available!
Smiths... 자세히보기 »
- 쓰레기 수거 서비스 | 수거 서비스를 거부 | 유해 폐기물의 수집 | 병원 및 실험실 폐기물 수집 및 처리 | 쓰레기 - 교통 서비스 | 국내 폐기물 수집 및 처리 | 폐기물 수집, 처리 및 처분 활동, 자료 복구 ...
- Sutton-in-Ashfield
- 영국
supplyautonomy.com/achristiessons.gb
Skip Hire in Glasgow
A Christie & Son are a professional Skip Hire, Scrap Metal & Recycling family run company helping with waste management throughout the Glasgow area, we offer skips of... 자세히보기 »
- 쓰레기 수거 서비스 | 수거 서비스를 거부 | 유해 폐기물의 수집 | 병원 및 실험실 폐기물 수집 및 처리 | 쓰레기 - 교통 서비스 | 국내 폐기물 수집 및 처리 | 폐기물 수집, 처리 및 처분 활동, 자료 복구 ...
- GLASGOW
- 영국
supplyautonomy.com/generay.gb
Skip Hire in Wembley
London Skip Hire company providing skips, Roll on/off and Grab Hire Services. No agency fees! Order on-line or call 0208 900 0828.
Fast and reliable service. Competitive prices... 자세히보기 »
- 쓰레기 수거 서비스 | 수거 서비스를 거부 | 유해 폐기물의 수집 | 병원 및 실험실 폐기물 수집 및 처리 | 쓰레기 - 교통 서비스 | 국내 폐기물 수집 및 처리 | 폐기물 수집, 처리 및 처분 활동, 자료 복구 ...
- Wembley
- 영국
supplyautonomy.com/kearneyskiphire.gb
Skip Hire in Wembley
Located in Wembley, T Kearney skip hire offer fast, friendly and reliable services. Skip permits are applied for and lights supplied if necessary to make ordering your skip as... 자세히보기 »
- 쓰레기 수거 서비스 | 수거 서비스를 거부 | 유해 폐기물의 수집 | 병원 및 실험실 폐기물 수집 및 처리 | 쓰레기 - 교통 서비스 | 국내 폐기물 수집 및 처리 | 폐기물 수집, 처리 및 처분 활동, 자료 복구 ...
- Wembley
- 영국
supplyautonomy.com/sbradyltd.gb
Skip Hire in Paisley
4,6, 8, 16,cubic yard skips for domestic ,industrial commercial hire, metal recycling, wood recycling paper recycling glass recycling tyre recycling
family run business, in... 자세히보기 »
- 쓰레기 수거 서비스 | 수거 서비스를 거부 | 유해 폐기물의 수집 | 병원 및 실험실 폐기물 수집 및 처리 | 쓰레기 - 교통 서비스 | 국내 폐기물 수집 및 처리 | 폐기물 수집, 처리 및 처분 활동, 자료 복구 ...
- Paisley
- 영국
supplyautonomy.com/allwasteberkshireltd.gb
Tool Hire Services in Slough
Low cost local skip hire avaiable as soon as you call!
Keywords: Roll on Roll off Skip, skips for hire, cheap skips, builders skips, skip hire, waste disposal
- 쓰레기 수거 서비스 | 수거 서비스를 거부 | 유해 폐기물의 수집 | 병원 및 실험실 폐기물 수집 및 처리 | 쓰레기 - 교통 서비스 | 국내 폐기물 수집 및 처리 | 폐기물 수집, 처리 및 처분 활동, 자료 복구 ...
- Slough
- 영국
supplyautonomy.com/bucksrecyclingltd.gb
Skip Hire in Aylesbury
We supply a comprehensive range of skips in Aylesbury, Thame, Bicester and Oxfordsire, including, mini skip hire, standard builder’s skips 6 & 8 yards; also 10, 12, ... 자세히보기 »
- 쓰레기 수거 서비스 | 수거 서비스를 거부 | 유해 폐기물의 수집 | 병원 및 실험실 폐기물 수집 및 처리 | 쓰레기 - 교통 서비스 | 국내 폐기물 수집 및 처리 | 폐기물 수집, 처리 및 처분 활동, 자료 복구 ...
- Aylesbury
- 영국
supplyautonomy.com/centralwaste.gb
Skip Hire in Nottingham
CENTRAL WASTE offers a wide selection of skips to Hire to the commercial and domestic customer, covering Hucknall & Nottingham. Call to discuss your requirments and our... 자세히보기 »
- 쓰레기 수거 서비스 | 수거 서비스를 거부 | 유해 폐기물의 수집 | 병원 및 실험실 폐기물 수집 및 처리 | 쓰레기 - 교통 서비스 | 국내 폐기물 수집 및 처리 | 폐기물 수집, 처리 및 처분 활동, 자료 복구 ...
- Nottingham
- 영국
supplyautonomy.com/simpsonskiphireltd.gb
Skip Hire in Romford
skip hire, ...
SKIP HIRE SERVICE TO EAST LONDON AND ESSEX BOARDERS.
Keywords: waste management, skip hire, waste removal
Opening Hours: Mon-Fri 06:00-22:00, Sat 07:00-13:00
- 쓰레기 수거 서비스 | 수거 서비스를 거부 | 유해 폐기물의 수집 | 병원 및 실험실 폐기물 수집 및 처리 | 쓰레기 - 교통 서비스 | 국내 폐기물 수집 및 처리 | 폐기물 수집, 처리 및 처분 활동, 자료 복구 ...
- Romford
- 영국
supplyautonomy.com/gowingpursey.gb
Skip Hire in London
Gowing & Pursey waste disposal and skip hire has been established for many years working throughout Acton London. We have have built up an impressive reputation over the... 자세히보기 »
- 쓰레기 수거 서비스 | 수거 서비스를 거부 | 유해 폐기물의 수집 | 병원 및 실험실 폐기물 수집 및 처리 | 쓰레기 - 교통 서비스 | 국내 폐기물 수집 및 처리 | 폐기물 수집, 처리 및 처분 활동, 자료 복구 ...
- London
- 영국
supplyautonomy.com/robertsrcompanyskiphirerailwaysleepers.gb
Skip Hire in Ilkeston
PROMPT RELIABLE SKIP HIRE. ALL SKIP SIZES AVAILABLE DOMESTIC & TRADE. WE ALSO SELL NEW AND USED RAILWAY SLEEPERS, TOPSOIL AND CRUSHED CONCRETE.
- 쓰레기 수거 서비스 | 수거 서비스를 거부 | 유해 폐기물의 수집 | 병원 및 실험실 폐기물 수집 및 처리 | 쓰레기 - 교통 서비스 | 국내 폐기물 수집 및 처리 | 폐기물 수집, 처리 및 처분 활동, 자료 복구 ...
- Ilkeston
- 영국