Matokeo ya: Nishati ya jua uzalishaji

Kupatikana 156 makampuni


supplyautonomy.com/energiatotal.br
Energia Total has dozens of Photovoltaic Solar Energy projects executed and in operation throughout Mato Grosso, both connected to the Concessionaire Grid (GridTie) in the Distributed Micro... Soma Zaidi »
  • Nishati ya jua jopo ufungaji | Nishati ya jua jopo paa-kufunika kazi | Nishati ya jua | Nishati ya jua uzalishaji |...
  • Cuiabá
  • Brazili
supplyautonomy.com/crosspolimerispa.it
Special, thermoplastic and cross-linkable compounds that are fire retardant and halogen free. Special polymers for reactive processes. Elastic components resistant to wear, climate conditions,... Soma Zaidi »
  • Uzalishaji wa umeme | Nishati ya jua uzalishaji | Baridi akavingirisha sehemu | Sehemu - metali zisizo na feri | Sehemu...
  • Sala Baganza
  • Italia
supplyautonomy.com/devamsolar.au
At Devam Solar, we're dedicated to revolutionizing the way you harness energy. As a top provider of solar solutions, we enable homeowners and businesses nationwide to adopt sustainable, clean... Soma Zaidi »
  • Nishati ya jua jopo ufungaji | Nishati ya jua jopo paa-kufunika kazi | Nguvu ya jua kupanda, photovoltaic kiini |...
  • Truganina
  • Australia
supplyautonomy.com/solarsmart.in
Solar Smart is the Best Solar Company in Ahmedabad, Gujarat. Get APS, Tata & Adani Solar Penal at an affordable price for your home - Solar Rooftop System Provider in Ahmedabad. We provide... Soma Zaidi »
  • Nishati ya jua jopo ufungaji | Nishati ya jua jopo paa-kufunika kazi | Nishati ya jua | Nishati ya jua uzalishaji |...
  • Ahmedabad
  • India
supplyautonomy.com/7f682bfa5387c20b86058eb9a5f8e8cca6afe7ac.us
Welcome to Solar4les, where passion meets purpose in the realm of solar energy solutions. Founded by Les Lovett, a visionary with a background in the mortgage industry, Solar4les represents a... Soma Zaidi »
  • Uzalishaji wa umeme | Nguvu ya jua kupanda, photovoltaic kiini | Nishati - mbadala | Nishati ya jua | Nishati ya jua...
  • Queen Creek
  • Marekani
supplyautonomy.com/teravasdnbhd.my
Tera Va Sdn Bhd was founded in 2011 when Malaysia's solar industry was just starting, and since then, our company has become a major player in the renewable solar energy sector. As a registered... Soma Zaidi »
  • Nishati ya jua | Nishati ya jua uzalishaji | Solpaneler | Nishati ya jua mifumo na vifaa vya | Nishati ya jua inverters...
  • Petaling Jaya
  • Malesia
supplyautonomy.com/solarconnectaustintexas.us
Solar Connect Austin is the premier solar company in the city of Austin Texas. Our goal is to empower residents and businesses in Austin, Texas by giving them control over their energy consumption... Soma Zaidi »
  • Nishati ya jua jopo paa-kufunika kazi | Nishati ya jua | Nishati ya jua uzalishaji | Nishati ya jua washauri | Nishati...
  • Austin
  • Marekani
supplyautonomy.com/aqsolarengineering.pk
"AQ Solar Engineering in okara is all-in-one solution for solar energy solutions for eco-friendly environment. Our preliminary products include solar panels, inverters, AC/DC breaker, dc wires,... Soma Zaidi »
  • Wiring huduma kwa ajili ya sekta ya umeme | Nishati - mbadala | Nishati ya jua | Nishati ya jua uzalishaji | Vyanzo vya...
  • Okara
  • Pakistani
supplyautonomy.com/sssouthlakesolar.us
Southlake Solar Installation, a trusted name in the solar industry, offers the highest-quality solar system installations in the Southlake area. Committed to customer satisfaction, our team uses the... Soma Zaidi »
  • Nishati - mbadala | Nishati ya jua | Nishati ya jua uzalishaji | Seli nishati ya jua, nishati ya jua jopo | Solpaneler...
  • Southlake
  • Marekani
supplyautonomy.com/powerfullygreen.us
At Powerfully Green, your solar experience is our top priority. We bring a local focus backed by 10 years of knowledge and experience, and we pride ourselves on acting as a community-minded solar... Soma Zaidi »
  • Nishati ya jua uzalishaji | Nishati ya jua washauri | Vifaa vya nishati ya jua | Solpaneler
  • St Paul
  • Marekani
supplyautonomy.com/azurepower.in
With an aim to become the lowest-cost power producer in the world, Azure power – a Solar Power Company – is on its way to power the world at a reduced cost. They are already selling solar power in Ind... Soma Zaidi »
  • Nishati ya jua jopo ufungaji | Nishati ya jua jopo paa-kufunika kazi | Nishati mbadala ya utafiti | Nguvu ya jua...
  • Delhi
  • India
supplyautonomy.com/powercomsolar.au
Looking for a solar power expertise company near your region? We are an experienced solar energy solutions provider in Tasmania. Call us on (03) 6229 7966.
  • Nishati ya jua jopo paa-kufunika kazi | Nishati ya jua uzalishaji | Nishati ya jua washauri | Nishati ya jua kwa...
  • Kingston
  • Australia
supplyautonomy.com/bluebirdsolar.in
Bluebird Solar is one of India’s leading solar panel manufacturers with the mission to deliver sophisticated solar power solutions to our customers. Backed by Bluebird Stabilisers we are a reputed b... Soma Zaidi »
  • Nishati ya jua uzalishaji | Seli nishati ya jua, nishati ya jua jopo
  • Delhi
  • India
supplyautonomy.com/electropalomo.es
  • Nishati ya jua | Nishati ya jua uzalishaji | Nguvu ya kizazi na vifaa vya maambukizi | Solpaneler | Photovoltaic paneli...
  • Onzonilla
  • Hispania
supplyautonomy.com/dosolarco.cn
Do Solar Co. Ltd is a leading Chinese manufacturer of a variety of solar modules ranging from 5W to 300W. Established in 2008 in response to an acknowledgement of the growing transition towards... Soma Zaidi »
  • Nishati ya jua uzalishaji | Umeme vipengele | Umeme na elektroniki bidhaa | Seli nishati ya jua, nishati ya jua jopo |...
  • Jinhua
  • China
supplyautonomy.com/magsolarwinnipeg.ca
MAG Solar Winnipeg streamlines the journey towards solar energy production. We offer comprehensive services ranging from planning and installation to ongoing maintenance.
  • Nishati - mbadala | Nishati ya jua | Nishati ya jua uzalishaji | Vyanzo vya nishati mbadala | Kuokoa nishati na...
  • Stonewall MB
  • Kanada
supplyautonomy.com/phocosamericasinc.us
The Phocos Any-GridTM PSW-H Inverter Charger Series (Pure Sine Wave Hybrid) represents Phocos’ most versatile line of inverters/chargers. Flexibility and reliability are key characteristics of this p... Soma Zaidi »
  • Nishati - mbadala | Nishati ya jua | Nishati ya jua uzalishaji | Vyanzo vya nishati mbadala | Kuokoa nishati na...
  • Tucson
  • Marekani
supplyautonomy.com/expertsolarpros.us
  • Nishati ya jua jopo ufungaji | Nishati ya jua jopo paa-kufunika kazi | Nguvu ya jua kupanda, photovoltaic kiini |...
  • Virginia Beach
  • Marekani
supplyautonomy.com/pickrenewenergypvt.in
Solar Company in Madhya Pradesh, Solar Company in Indore, Best Solar Company in India, Best Solar Company in Indore, Best Solar Company in Madhya Pradesh, Rooftop solar for home, Rooftop solar for... Soma Zaidi »
  • Nishati ya jua jopo ufungaji | Nishati ya jua jopo paa-kufunika kazi | Nishati ya jua uzalishaji | Nishati ya jua...
  • Indore
  • India
supplyautonomy.com/suvastikasystemsprivatelimited.in
We are in inverter, UPS and solar products along with the lithium battery. Lift inverters etc Pls let me know what all you need and once we get results we will be your permanent customer.Su-Vastika... Soma Zaidi »
  • Nishati ya jua uzalishaji | Nishati ya jua washauri | Lithiamu ackumulatorer | Nishati ya jua bidhaa na vifaa vya |...
  • Gurgaon
  • India
supplyautonomy.com/greenreliance.au
Green Reliance is an Australian Solar Installation company that is CEC accredited and provides high quality systems at reasonable prices.Want to use renewable energy to lessen your electricity... Soma Zaidi »
  • Nishati ya jua | Nishati ya jua uzalishaji | Nishati ya jua washauri | Nishati ya jua - mitambo | Vifaa vya nishati ya...
  • Wayville
  • Australia
supplyautonomy.com/macedonrangessolarpower.au
Macedon Ranges can create a solar power system designed for your electric power consumption in your home or business. As a company, we believe in offering our clients a solid and direct pathway to... Soma Zaidi »
  • Nishati ya jua jopo ufungaji | Nishati ya jua | Nishati ya jua uzalishaji | Nishati ya jua na nishati mbadala | Nishati...
  • New Gisborne
  • Australia
supplyautonomy.com/qingdaotaidanewenergyco.cn
Qingdao Taida New Energy Co., Ltd. is a leading manufacturer of solar powered products in China. With more than five years of solar powered product manufacturing experience, we specialize in the... Soma Zaidi »
  • Nishati ya jua uzalishaji | Umeme vipengele | Seli nishati ya jua, nishati ya jua jopo | Incandescent taa | Nishati ya...
  • Qingdao
  • China
supplyautonomy.com/zhejiangraileysolarenergyproducts.cn
Established in 1999, Zhejiang Railey Solar Energy Co., Ltd. is a professional enterprise in solar application technique research, manufacture and market promotion, with Rili as our brand. We are one... Soma Zaidi »
  • Nishati ya jua uzalishaji | Nishati ya jua watoza | Nishati ya jua bidhaa na vifaa vya
  • Shangyu
  • China
supplyautonomy.com/northhighlandssolarpanelcleaning.us
# 1 Concrete Solar Panel Cleaning Company in North Highlands CA and the surrounding areas in Sacramento County. Call us today for a free estimate! Or visit us on our website for more details about... Soma Zaidi »
  • Nishati ya jua jopo ufungaji | Nishati ya jua jopo paa-kufunika kazi | Nishati ya jua uzalishaji | Capacitors, fasta,...
  • North highlands
  • Marekani
supplyautonomy.com/jgsolarsolutions.us
JG Solar Solutions is dedicated to providing top-tier solar energy solutions for residential and commercial clients. Our expert team designs and installs efficient, cost-effective solar systems that... Soma Zaidi »
  • Nishati ya jua uzalishaji
  • Midlothian
  • Marekani
supplyautonomy.com/australiansolardesigns.au
Australian Solar Designs Pty Ltd (ASD) was established in 2009 and is run by a team of industry professionals with vast solar experience and a passion for contributing to Australia’s Clean Energy F... Soma Zaidi »
  • Nishati ya jua jopo ufungaji | Nishati ya jua jopo paa-kufunika kazi | Nguvu ya jua kupanda, photovoltaic kiini |...
  • Alexandria
  • Australia
supplyautonomy.com/customizedsolarsolutions2.us
We offer a comprehensive approach to solar energy that ensures peace of mind and longevity. Our 25-year warranty on the entire system covers all aspects, including the micro-inverter, panels, wiring,... Soma Zaidi »
  • Nishati ya jua jopo ufungaji | Nishati ya jua uzalishaji | Nishati ya jua washauri | Nishati ya jua vifaa, wazalishaji...
  • Port St. Lucie
  • Marekani