Loading...
Kết quả tìm kiếm cho: Chất thải hóa học - thu thập và tái chế
Công ty 219 được tìm thấyCác loại liên quan
Danh sách ưa thích liên quan đến: Chất thải hóa học - thu thập và tái chế
supplyautonomy.com/gironifrancescocspa.it
Purchase and sale of scrap metal and all types of metals with interchangeable trash bin collection service. Authorised to collect and transport special waste and used batteries, as well as their... Đọc thêm »
- Vận chuyển chất thải | Khử nhiễm chất thải công nghiệp | Từ chối điều trị - công ty | Xây dựng các mảnh vỡ - tái chế | Q...
- Bologna
- Ý
supplyautonomy.com/hackhamrecyclers.au
As a family based local business, Hackham Recyclers is one of the leading firms in the recycling industry in Adelaide.
Hackham Recyclers takes pride in offering efficient recycling services of... Đọc thêm »
- Bộ sưu tập kim loại phế liệu và xử lý | Tái chế các loại hóa chất | Tái chế các dịch vụ cho máy in hộp mực laser | Tái c...
- Hackham
- Úc
supplyautonomy.com/leeaimportexport.tr
We are traders of carbon and graphite components for submersible motors. We trade carbon bearings, carbon thrust bearings and complete thrust sets (carbon thrust bearing, metal base, and segmented... Đọc thêm »
- Tái sinh của các chất xúc tác | Dịch vụ tái sinh cho than hoạt tính | Phục hồi và tái sinh của các hóa chất chụp ảnh | P...
- İstanbul
- Thổ Nhĩ Kỳ
supplyautonomy.com/suchetanexportspvt.in
This Group company born on 13th June, 1989 has the distinction of being the biggest player in the Raw cotton / Cotton waste trade.
It has its offices at various places in India and has its global... Đọc thêm »
- Dịch vụ xử lý máy kéo | Dịch vụ xử lý chất thải dệt may, len | Dịch vụ xử lý chất thải dệt may, tóc | Dịch vụ xử lý chất...
- Mumbai
- Ấn Độ
supplyautonomy.com/plasticalgroupsl.es
supplyautonomy.com/tbfenvironmentaltechnology1.ca
TBF Environmental Technology manufactures innovative solvents which reduce the atmospheric emission of VOCs, HAPs and GHGs. TBF\'s non-toxic solvents reduce the health risk to ten million US... Đọc thêm »
- Phục hồi và tái sinh của các hợp chất hữu cơ dễ bay hơi (VOC) | Nghiên cứu công nghệ môi trường...
- Surrey
- Ca-na-đa
supplyautonomy.com/haldortopsoeeinternationalas.dk
Profil Haldor Topsøe's technologies and catalysts are used around the world creating a better environment - in the refining industry ensuring cleaner fuels, for cleaning power industry flue ... Đọc thêm »
- Tái sinh của các chất xúc tác | Dịch vụ tái sinh cho than hoạt tính | Phục hồi và tái sinh của các hóa chất chụp ảnh | P...
- Lyngby
- Đan Mạch
supplyautonomy.com/nettoyageserigraphie.fr
supplyautonomy.com/ecosistemspa.it
Eco Sistem works in the waste management and disposal sector, organises the dismantling of industrial and small-scale manufacturing, construction and public institution inventory surpluses. Offers... Đọc thêm »
- Khử nhiễm chất thải công nghiệp | Vệ sinh môi trường | Loại bỏ amiăng - nhà thầu | Chất thải hóa học - thu thập và tái c...
- Rome
- Ý
supplyautonomy.com/johnsonmattheyfuelcellslimited.gb
Export Johnson Matthey is a speciality chemicals company focussed on its core skills in precious metals, catalysts and fine chemicals. It is organised into three global divisions: Environmental... Đọc thêm »
- Tái sinh của các chất xúc tác | Dịch vụ tái sinh cho than hoạt tính | Phục hồi và tái sinh của các hóa chất chụp ảnh | P...
- London
- Vương quốc Anh
supplyautonomy.com/lassilatikanojaoyj.fi
Company Profile: Lassila & Tikanoja is a service company that is transforming the consumer society into an efficient recycling society. . In co-operation with our customers we are reducing... Đọc thêm »
- Chất thải cải tạo và tư vấn xử lý | Cài đặt và thiết bị (thuê / cho thuê) vệ sinh | Thùng rác (thuê / cho thuê) | Máy ép...
- HELSINKI
- Phần Lan
supplyautonomy.com/uspnettoyage.fr
- Phát hiện và vị trí dịch vụ rò rỉ, đường ống | Phòng sạch, các dự án chìa khóa trao tay | Nhà máy nhiên liệu sinh học, c...
- Arcueil
- Pháp
supplyautonomy.com/cometamsa.fr
supplyautonomy.com/orcofasas.fr
- Chất thải cải tạo và tư vấn xử lý | Dịch vụ phục hồi sự cố cho phương tiện đường bộ nặng | Thùng rác (thuê / cho thuê) |...
- Aix-en-Provence
- Pháp
supplyautonomy.com/seaserviziecologiciambientalisrl.it
Environmental safety. Sea Ambiente operates its own installations and is able to offer environmentally-responsible storage and processing of all type of industrial waste, hazardous and non-hazardous.... Đọc thêm »
- Khử nhiễm chất thải công nghiệp | Từ chối điều trị - công ty | Xử lý nước thải công nghiệp | Phân loại chất thải - máy m...
- Camerata
- Ý
supplyautonomy.com/lgobbisrl.it
- Dịch vụ sản xuất, bổ sung chế độ ăn uống | Tái sinh của các chất xúc tác | Dịch vụ tái sinh cho than hoạt tính | Phục hồ...
- CAMPO LIGURE (GE)
- Ý
supplyautonomy.com/ibhw2econsultantssa.be
Environmental projects and waste management - Construction cost consultancy - Engineering and construction supervision. Integration in the group VK Engineering - www.vkgroup.be
- Chất thải cải tạo và tư vấn xử lý | Cài đặt và thiết bị (thuê / cho thuê) vệ sinh | Bỏ qua (thuê / cho thuê) | Thùng rác...
- Lasne
- Bỉ
supplyautonomy.com/greencrosshealthinnovation.in
Green Cross Health Innovation with an objective to provide healthcare solutions, without side effects, launches its brand VitaGreen. The company produces an extensive range of Ayurveda/Herbal... Đọc thêm »
- Phục hồi và tái sinh của các hợp chất hữu cơ dễ bay hơi (VOC) | Bài viết dược phẩm | Sản phẩm tiêu hóa chăm sóc sức khỏe...
- Mumbai
- Ấn Độ
supplyautonomy.com/santengineeringcompany.in
Manufacturer & Exporters of Rubber Processing Machines like Mixing Mill, Dispersion Kneader, Rubber Calendars, Extruder Machine, Rubber Bale Cutter, Tyre Building Machine, Rubber Refiner... Đọc thêm »
- Nhập khẩu, xuất khẩu, khoáng sản không kim loại | Đại lý mua hàng, cao su và nhựa | Thương hàng hóa, nhựa tự nhiên và nư...
- Ambala City
- Ấn Độ
supplyautonomy.com/mahavirrefractoriescorporation.in
Manufacturer and Exporters of Stockists of all Types of Refractories High Alumina, Silliminate, Insulation, Acid Proof Brick Castable, Fire Cements and Fire Clay of all Grades Ceramic, Blankets,... Đọc thêm »
- Tái sinh của các chất xúc tác | Dịch vụ tái sinh cho than hoạt tính | Phục hồi và tái sinh của các hóa chất chụp ảnh | P...
- Mumbai
- Ấn Độ
supplyautonomy.com/islandwidemarketingservicespvt.lk
Import & Supply of Industrial Chemicals,Machinery Lab Equipment,Packaging along with the Technological Inputs & Clearing & Forwarding Agents,Export of Coconut based... Đọc thêm »
- Phục hồi và tái sinh của các hợp chất hữu cơ dễ bay hơi (VOC) | Dịch vụ thanh lọc protein | Sàng lọc chất lỏng cho công ...
- Rajagiriya
- Sri Lanka
supplyautonomy.com/developpementbernardplasencia.fr
- Chuyên gia tư vấn kỹ thuật sản xuất dược phẩm | Chuyên gia tư vấn kỹ thuật sinh hóa | Dịch vụ tái sinh cho than hoạt tín...
- Saint-Priest
- Pháp
supplyautonomy.com/yittietotekniikkaoy.fi
Company profile: YIT in brief At YIT we build, develop and maintain a good living environment for people in the Nordic countries, Central Europe, Russia and the Baltic countries. We offer solutions... Đọc thêm »
- Chất thải cải tạo và tư vấn xử lý | Chuyên gia tư vấn địa kỹ thuật | Thùng rác (thuê / cho thuê) | Máy ép chất thải (thu...
- Helsinki
- Phần Lan
supplyautonomy.com/basfautomotivecoatingsservices.fr
- - Nhà thầu công nghiệp | Văn phòng được trang bị và cơ sở công nghiệp - dịch vụ | Nhà cho trẻ em | Tái sinh của các chất...
- Breuil
- Pháp
supplyautonomy.com/braunschweigerversorgungsagcokg.de
- Chất thải cải tạo và tư vấn xử lý | Dịch vụ giao thông công cộng, đường sắt, dịch vụ thành phố | Xe buýt và huấn luyện v...
- Brunswick
- Đức
supplyautonomy.com/johnsonmattheybrandenbergerag.ch
- Trang sức và bijouterie | Tái sinh của các chất xúc tác | Dịch vụ tái sinh cho than hoạt tính | Phục hồi và tái sinh của...
- Zürich
- Thụy Sĩ
supplyautonomy.com/cilajenergias.dk
- Chất thải cải tạo và tư vấn xử lý | Container hàng hóa và thùng (thuê / cho thuê) | Thùng rác (thuê / cho thuê) | Máy ép...
- Harboøre
- Đan Mạch
supplyautonomy.com/norskmiljogresirkuleringas.no
- Tái sinh của các chất xúc tác | Dịch vụ tái sinh cho than hoạt tính | Phục hồi và tái sinh của các hóa chất chụp ảnh | P...
- Oslo
- Na Uy
supplyautonomy.com/isovatoras.no
- Tái sinh của các chất xúc tác | Dịch vụ tái sinh cho than hoạt tính | Phục hồi và tái sinh của các hóa chất chụp ảnh | P...
- Hokksund
- Na Uy
supplyautonomy.com/parkoviplusdoo.hr
- Chất thải cải tạo và tư vấn xử lý | Nhà thầu | Thùng rác (thuê / cho thuê) | Máy ép chất thải (thuê / cho thuê) | Ống vé...
- Rijeka
- Croatia