Loading...
కోసం శోధన ఫలితాలు: రసాయనాలు మరియు రసాయన ఉత్పత్తులను తయారుచేసి
దొరకలేదు 488 కంపెనీలుసంబంధిత వర్గాలు
supplyautonomy.com/univar.fr
- కెమికల్స్ - దిగుమతి-ఎగుమతి | ప్రోటీన్ శుద్దీకరణ సేవలు | రసాయన పరిశ్రమ కోసం ముద్ద యొక్క Sieving | రసాయన పరిశ్రమ కోసం ఎయిర...
- Fontenay-sous-Bois
- ఫ్రాన్స్‌
supplyautonomy.com/sofresidengineering.fr
- పైప్ వర్క్ కాంట్రాక్టర్లు, రసాయన మరియు అణు ప్రసరించే వ్యవస్థలు | పైప్ వర్క్ సంస్థాపన కాంట్రాక్టర్లు, రసాయన మొక్క | పై...
- Montigny-le-Bretonneux
- ఫ్రాన్స్‌
supplyautonomy.com/sweco.us
- రసాయన పరిశ్రమ కోసం ఘనాలు యొక్క Sieving | గాలిలో, భోజనం, తినదగిన కూరగాయల నూనె ప్రాసెసింగ్ | హీటర్లు, తినదగిన గింజలు | తిన...
- Florence
- సంయుక్త రాజ్య అమెరికా
supplyautonomy.com/hosokawamicronlimited.gb
Hosokawa Micron Ltd is your single source for integrated powder processing systems and containment solutions. Our core products and services include particle design for nano technology, size... మరింత చదవండి »
- టెక్నాలజీ ఇంజనీరింగ్ కన్సల్టెంట్స్ మిక్సింగ్ మరియు కలుపుతూ | ఉత్పత్తి సేవలు, ఆహార ప్రత్యామ్నాయాలు | ఔషధాల మిశ్రణం | ఔషధా...
- Runcorn
- బ్రిటన్
supplyautonomy.com/gujaratfluorochemicalslimited.in
Gujarat Fluorochemicals Limited (GFL) is an Indian Chemicals Company with over 30 years of expertise in Fluorine Chemistry. GFL holds domain expertise in Fluoropolymers, Fluorospecialities,... మరింత చదవండి »
- రసాయనాల ఉత్పత్తి | కెమికల్స్
- Noida
- భారత దేశం
supplyautonomy.com/texmor.mx
In 1981, the painting factory Permil S.A. of C.V. I think you will sit in the market of the surest. Our mission is to protect and decorate beautifully designed motifs for the three brothers, written... మరింత చదవండి »
- రంగులు మరియు వర్ణాలు తయారీ | రంగులు, చెక్క వస్తువులపై వేసే రంగులు మరియు ఇటువంటి పూతలు, ప్రింటింగ్ ఇంక్ మరియు mastics తయ...
- Xochitepec
- మెక్సికో
supplyautonomy.com/embelezarkosmetikinstitut.ca
So wie ich mir für meine Haut nur das Beste gönne, lege ich auch in meinem Kosmetikstudio in Frankfurt größten Wert auf die Qualität meiner kosmetischen Produkte und Behandlungen. Als langjährig erfah... మరింత చదవండి »
- సౌందర్య చికిత్స సేవలు | సౌందర్య ప్రాసెసింగ్
- Frankfurt am Main
- ఙర్మని
supplyautonomy.com/shandongrunkechemicalco.cn
Shandong Runke Chemical Co., Ltd. was established in 2006 and finished holding and restructuring of Weifang Dacheng Salinization Co., Ltd. to the company in 2010. With a registered capital of 40... మరింత చదవండి »
- ఇతర రసాయన ఉత్పత్తులు తయారు n.e.c. | రసాయన ఉత్పత్తులు | , బ్రోమిన్ ఘన, ద్రవ లేదా వాయు...
- Weifang
- చైనా
supplyautonomy.com/shandongsunshinechemicaltechnologyco.cn
Shandong Sunshine Chemical Technology Co., Ltd. specializes in R&D, production and management of disinfectant, additives and polymer, and its factory was built in accordance with GMP standards.... మరింత చదవండి »
- ఇతర రసాయన ఉత్పత్తులు తయారు n.e.c. | ఈత కొలనుల క్లోరిన్ జనరేటర్లు | రసాయన ఉత్పత్తులు | రసాయనాలు మరియు రసాయన ఉత్పత్తులను త...
- Yanggu
- చైనా
supplyautonomy.com/northeastagrochem.cn
Agrochemicals products.
Main products: Malathion, Chlorpyrifos, Thiamethoxam, and others. (Technical and Formulation)
Aгрохимикатов продукции.
Основная продукция: Малатион, Хлорпирифос, Тиаметокса... మరింత చదవండి »
- పురుగుమందులు మరియు ఇతర వ్యావసాయిక రసాయనం ఉత్పత్తుల తయారీకి | ఆగ్రోకెమికల్ స్ | నేలకు వేసే రసాయనిక ఎరువు | ఇతర ఆగ్రోకెమిక...
- Jinxi
- చైనా
supplyautonomy.com/chemiplastinternational.pk
Chemiplast International is a strong, family rooted company – founded by a cotton trading veteran Mr. Abid Ali (late) in 1999 with a vision to make Chemiplast one of the leading trading companies ... మరింత చదవండి »
- పాలియురేతేన్ (పు) | పాలిమర్స్ | ద్రావకాలు | ఇతర రసాయన ఉత్పత్తులు తయారు | రసాయనాలు మరియు రసాయన ఉత్పత్తులను తయారుచేసి...
- Karachi
- పాకిస్తాన్
supplyautonomy.com/varunpolymers.in
Varun Polymers is one of the leading manufacturer and exporter in India, of premium quality recycled rubber products. We manufacture rubber reclaiming agent such as:
1 Di Aryl Di Sulphide
2 ... మరింత చదవండి »
- కస్టమ్ రసాయన సేవలు | బాల్ కవాటాలు | ప్లాస్టిక్ ఉత్పత్తులు | సంసంజనాలు మరియు టేప్ | Moulded భాగాలు, ఫ్యూజ్డ్ క్వార్ట్జ్...
- Ahmedabad
- భారత దేశం
supplyautonomy.com/todecasa.es
- వర్గీకరణ సేవలు, ఫైన్ కెమికల్స్ | రసాయనాల స్వేదనం | పానీయాల పరిశ్రమకు ఈస్ట్ | ఈస్ట్, రొట్టె తయారీదారుల ' | మిఠాయి ఈస్ట్,...
- Barcelona
- స్పేన్
supplyautonomy.com/eastmanchemicalcompany.us
- కస్టమ్ రసాయన సేవలు | సోడియం, ద్రవ | సోడియం metabisulphite / సోడియం pyrosulphite | సోడియం methoxide / సోడియం మిథైల్ను | ...
- Kingsport
- సంయుక్త రాజ్య అమెరికా
supplyautonomy.com/sudarshandhoopp.in
Manufacturers and Exporters of Incense Products like Dhoop, Agarbathi Coils and Cones, Extruded Bambooless Sticks, Incense Sticks, Magical Charcoal Tablets, Pure Natural Agarbatti, Incense Gift Sets... మరింత చదవండి »
- ఉత్పత్తి సేవలు, ఆహార ప్రత్యామ్నాయాలు | సేవలు, ద్రావకాలు మరియు ADHESIVES, పారిశ్రామిక నింపే మరియు ప్యాకేజింగ్ | ఔషధాల మిశ...
- New Delhi
- భారత దేశం
supplyautonomy.com/stridesarcolab.in
Manufacturer, Exporters and Importers of Antibiotics, Cephalophins, Nutracentieah, HIV Rearoviral, Vitamins, Soft Gelatin Capsule, Tablet, Liquid Injection, Dry Powder Injection, Oral Solid Dosage... మరింత చదవండి »
- ఉత్పత్తి సేవలు, ఆహార ప్రత్యామ్నాయాలు | ఔషధాల మిశ్రణం | ఔషధాల ఎండబెట్టడం SPRAY | ప్రోటీన్ శుద్దీకరణ సేవలు | మానవ హార్మోన్...
- Bengaluru
- భారత దేశం
supplyautonomy.com/islandwidemarketingservicespvt.lk
Import & Supply of Industrial Chemicals,Machinery Lab Equipment,Packaging along with the Technological Inputs & Clearing & Forwarding Agents,Export of Coconut based... మరింత చదవండి »
- రికవరీ మరియు బాష్పశీల కర్బన సమ్మేళనాలు పునరుత్పత్తి (VOC) | ప్రోటీన్ శుద్దీకరణ సేవలు | రసాయన పరిశ్రమ కోసం ద్రవాలు యొక్క ...
- Rajagiriya
- శ్రీలంక
supplyautonomy.com/developpementbernardplasencia.fr
- ఔషధ ఉత్పత్తి ఇంజనీరింగ్ కన్సల్టెంట్స్ | జీవరసాయన ఇంజనీరింగ్ కన్సల్టెంట్స్ | ఉత్తేజిత కార్బన్ కోసం పునరుత్పత్తి సేవలు | ర...
- Saint-Priest
- ఫ్రాన్స్‌
supplyautonomy.com/aircontrolsa.es
- చల్లబరిచే ప్లాంట్, చెరశాల కావలివాడు ప్రాజెక్టులు | ఉత్పత్తి సేవలు, ఆహార ప్రత్యామ్నాయాలు | ఔషధాల మిశ్రణం | ఔషధాల ఎండబెట్ట...
- San Sebastián
- స్పేన్
supplyautonomy.com/borgessa.es
- Grouting, ప్లాస్టర్ ఆధారంగా | ఉత్పత్తి సేవలు, ఆహార ప్రత్యామ్నాయాలు | వస్తువు వ్యాపారులు, ముడి రబ్బరు మరియు రబ్బరు పాలు |...
- Reus
- స్పేన్
supplyautonomy.com/crealis.fr
- నిర్వహణ సలహా | రసాయనాల స్వేదనం | విద్యుత్ మరియు ఎలక్ట్రానిక్ సంస్థాపనలు, ఉత్పత్తులు, రసాయన క్లీనింగ్ | డేటా ప్రాసెసింగ్ ...
- Bry
- ఫ్రాన్స్‌
supplyautonomy.com/novissrl.it
- సంకలనం సేవలు, రసాయన | లోహాలు కోసం Chromating రసాయనాలు | క్రోమియం లేపన రసాయనాలు | ఇంధన చమురు కోసం సంకలితం, రసాయన, | ఎస్సె...
- Calenzano
- ఇటలి
supplyautonomy.com/azelisfrance.fr
- ఉత్పత్తి సేవలు, ఆహార ప్రత్యామ్నాయాలు | కెమికల్స్ - దిగుమతి-ఎగుమతి | ఔషధాల మిశ్రణం | ఔషధాల ఎండబెట్టడం SPRAY | ప్రోటీన్ శు...
- Paris
- ఫ్రాన్స్‌
supplyautonomy.com/epiingredients.fr
- ఔషధాల మిశ్రణం | రసాయన పరిశ్రమ కోసం రంగులు మరియు వర్ణాలు యొక్క మిశ్రణం | అల్లం నూనె | పొడి మరియు ఘనీకృత పాలు | పానీయాల పర...
- Ancenis
- ఫ్రాన్స్‌
supplyautonomy.com/ktronfrance.fr
- ఉత్పత్తి సేవలు, ఆహార ప్రత్యామ్నాయాలు | సేవలు, ద్రావకాలు మరియు ADHESIVES, పారిశ్రామిక నింపే మరియు ప్యాకేజింగ్ | ఔషధాల మిశ...
- Croissy-sur-Celle
- ఫ్రాన్స్‌
supplyautonomy.com/lgobbisrl.it
- ఉత్పత్తి సేవలు, ఆహార ప్రత్యామ్నాయాలు | ఉత్ప్రేరకంగా పునరుత్పత్తి | ఉత్తేజిత కార్బన్ కోసం పునరుత్పత్తి సేవలు | ఫోటోగ్రాఫి...
- CAMPO LIGURE (GE)
- ఇటలి
supplyautonomy.com/toshniwalsystemsandinstrumentsprivatelimited.in
Manufacturers, Exporters & Importers Of Oval Gear Meter, Turbine Flow Meter, Vortex Meter, Density Meter, Cone Meter, Clamp On Ultrasonic Meter, Magnetic Inductive Flow Sensor, Flow Computer,... మరింత చదవండి »
- ఉత్పత్తి సేవలు, ఆహార ప్రత్యామ్నాయాలు | ఔషధాల మిశ్రణం | ఔషధాల ఎండబెట్టడం SPRAY | ప్రోటీన్ శుద్దీకరణ సేవలు | మానవ హార్మోన్...
- Chennai
- భారత దేశం
supplyautonomy.com/standardplasticatehnicsrl.ro
- మొక్క మరియు పరికరాలు ఇంజనీరింగ్ కన్సల్టెంట్స్ PACKAGING మరియు నింపి | ముద్రిత సర్క్యూట్ బోర్డు (PCB) మరియు ఉపరితల మౌంట్ ...
- Bucuresti
- రోమానియా
supplyautonomy.com/spolpharmasro.cz
- మిక్సింగ్ మరియు రసాయన పరిశ్రమ కోసం ముద్ద యొక్క కలుపుతూ | స్టెయిన్లెస్ స్టీల్, ఆధారంగా కృత్రిమ కందెన కోసం ముద్ద కట్టింగ్ ...
- Olomouc
- చెక్ గణరాజ్యం
supplyautonomy.com/nopcopapertechnologysl.es
- ఉత్పత్తి సేవలు, ఆహార ప్రత్యామ్నాయాలు | ప్రసరించే మరియు మురికి నీటిని నుండి నూనెలు మరియు కొవ్వులు యొక్క రికవరీ | ఔషధాల మి...
- Terrassa
- స్పేన్