Loading...
ძებნის შედეგები: შეფუთვის მანქანები
ნაპოვნია 7631 კომპანიებიამავე კატეგორიაში
supplyautonomy.com/pentagonmarketing.in
Available in various dimensions, specifications, capacities, efficiency, etc, packaging machinery find applications in various industries like chemical, marine, food, etc. Pentagon Marketing is... დაწვრილებით »
- პრინტერები, ფოტოს | მარკერი კალმები | ადჰეზივები და ფირზე | შეფუთვის მანქანები...
- Kochi
- ინდოეთი
supplyautonomy.com/taisunmachinery.tw
Tai sun machinery Co., ltd has been concentrating on the manufacture of the tissue paper converting machine since 1970. Now the "tai sun" brand has successfully exported
A big quantity of... დაწვრილებით »
- პირსახოცის მიღების მანქანა | შეფუთვის მანქანები...
- Taipei
- ტაივანი
supplyautonomy.com/iterrainintlenterprisesco.tw
In the manufacture of those machines we use the most advanced modern techniques. We take pride in having offered the overseas markets products of unsurpassed quality and appearance for the 27 years.... დაწვრილებით »
- ყავა ლობიო, ჯავა | სხვა მეორადი მანქანები | შეფუთვის მანქანები...
- Taichung
- ტაივანი
supplyautonomy.com/masaelimachinemanufacturing.ir
Masaeli Industry Machinery is a leading company is Iran`s packing industry founded in 1983.Our main products include pillow packing machines that are suitable for packing all of things in different... დაწვრილებით »
- შეფუთვის მანქანები | შეფუთვის ხაზი
- Esfahan
- ირანი
supplyautonomy.com/ptsancoindonesia.id
Sanco international based in Jakarta, Indonesia is a marketing arms company that owns an exclusive right to promote and to distribute end products from manufacturer of confectionery products in... დაწვრილებით »
- Capsule შევსების მანქანა | შეფუთვის მანქანები
- Jakarta
- ინდონეზია
supplyautonomy.com/baodingjialifoodmachine.cn
Established in 1998, Baoding Jiali Food Machine Co.,ltd is a professional manufacturer engaged in research, development, production, sale and service of all kinds of food machines. Excellent... დაწვრილებით »
- კვების მრეწველობის მოწყობილობები და აღჭურვილობები nes | შეფუთვის მანქანები...
- Baoding
- ჩინეთი
supplyautonomy.com/zhejiangruianyongxinmachineryfactory.cn
Ruian Yongxin Machinery Factory is located in Ruian, Zhejiang province, the famous City of Packaging Machinery in China. It always devotes itself to researching and developing packaging or... დაწვრილებით »
- სხვა ფარმაცევტული დანადგარები | შეფუთვის მანქანები...
- Ruian
- ჩინეთი
supplyautonomy.com/zhangjiagangkingstepmachineryco.cn
Our quality products are:
Pure/Mineral water production lines
Carbonated drink production lines;
Fruit juice production lines
Tea drink production lines
Soy milk and protein drink production... დაწვრილებით »
- სუფთა წყლის | შეფუთვის მანქანები
- Suzhou
- ჩინეთი
supplyautonomy.com/nissionfoodmachinerycorporation.cn
Qingdao Nissin Food Machinery Co., Ltd. is a Sino-Japanese joint venture established in 1989. Our company applies complete Japanese technology, blueprints and components and works together with... დაწვრილებით »
- Snack მანქანა | შეფუთვის მანქანები
- Qingdao
- ჩინეთი
supplyautonomy.com/hbfpt.cn
Our company originates at the beginning of the 1990. Our predecessor is the Shijjiazhuang Changan Stainless Steel Plant, with the registered capital of 1,800,000 and a staff of 70 people.
Our... დაწვრილებით »
- კვების მრეწველობის მოწყობილობები და აღჭურვილობები nes | ლიფტი მაგიდები | შეფუთვის მანქანები | Staples, მავთული...
- Shijiazhuang
- ჩინეთი
supplyautonomy.com/guangzhouhaochiwoodworkingmachineryco.cn
Guangzhou JianChi Woodworking Machinery Co., Ltd. locates in ShaWan Town, Panyu Area, Guangzhou City. We have been insisting on the aim of "survive with quality and develop with... დაწვრილებით »
- შეფუთვის მანქანები | ხის აღჭურვილობა
- Guangzhou
- ჩინეთი
supplyautonomy.com/greatelectricsmachineco.cn
Since our establishment in 1989, Great-Electrics Machine Co., Ltd. has been the leading manufacturer in the thermoforming machine industry in China. We have a strong research and development team to... დაწვრილებით »
- შედუღების მოწყობილობები | პლასტიკური შემდუღებლები | შეფუთვის მანქანები | კვერცხი ქაღალდის...
- Guangzhou
- ჩინეთი
supplyautonomy.com/jayengineeringcombine.in
Standard spares and machineries for soap, detergent, chemicals HVAC Plants
JAY ENGINEERING... დაწვრილებით »
- შეფუთვის მანქანები
- Ahmedabad
- ინდოეთი
supplyautonomy.com/bossengineeringcompany.in
Backed by industry experience of about a decade, we are engaged in manufacturing a completely automatic range of machines used in filling, capping, and labeling of bottles and containers. Our range... დაწვრილებით »
- შეფუთვის მანქანები | ფარმაცევტული შეფუთვა მანქანა | სხვა შესაფუთ...
- Ahmedabad
- ინდოეთი
supplyautonomy.com/shreejipharmatech.in
About Us
Shreeji Pharmatech is one of the pioneering manufacturers of a wide range of Pharmaceutical Machineries like Dry Injectable Powder Filling Machine, Semi-automatic Dry Injectable Powder... დაწვრილებით »
- სხვა ტექსტილის მანქანა | შეფუთვის მანქანები
- Ahmedabad
- ინდოეთი
supplyautonomy.com/masterfil.gb
The Adelphi Group of Companies has served customers all over the world for over 60 years. Our products range form simple stainless steel vessels to complete turnkey filling and capping lines, all... დაწვრილებით »
- შეფუთვა და დაფასოება - მანქანები და მოწყობილობა | დრამი, pails და ბარელი...
- Aylesbury
- დიდი ბრიტანეთი
supplyautonomy.com/susmatexmachinery.in
Dear Visitors and customers,
First of all, we would like to tell thanks to visitors and customers who visiting our website, so we are greatly pleased to introduce our company and our products to... დაწვრილებით »
- Lace მანქანები | შეფუთვის მანქანები
- Ahmedabad
- ინდოეთი
supplyautonomy.com/omchamundaenterprises.in
A om chamunda enterprisesis one of the leading manufacturer, exporter and supplier of packaging machine from India. Designed for efficient operation to meet the varying requirements of different... დაწვრილებით »
- Capsule შევსების მანქანა | შეფუთვის მანქანები
- Mumbai
- ინდოეთი
supplyautonomy.com/shrivinayakpackagingmachinepvt.in
Incorporated in the year 2000, Shri Vinayak Print-Pack is a leading importer and supplier of packaging machines. The range includes semi / fully automatic packaging machines, strapping machines,... დაწვრილებით »
- შეფუთვის მანქანები | Strapping
- New Delhi
- ინდოეთი
supplyautonomy.com/labhprojectspvt.in
Welcome to Labh Group!
Labh Group of Companies is a fast growing, well- recognized and an ISO 9001:2008 certified, Indian business group of global repute having presence in more than 100 countries... დაწვრილებით »
- რაისი ჩანთა | შეფუთვის მანქანები | Strapping
- Ahmedabad
- ინდოეთი
supplyautonomy.com/rubyenterprise.in
Jaw crusher, complete crushing plant screening plant
- კარგად საბურღი დანადგარები | გამოიყენება სამთო მანქანა | შეფუთვის მანქანები...
- Hooghly
- ინდოეთი
supplyautonomy.com/brintexsalescorporation.in
Unicon Exports and Imports, is an acknowledged manufacturer and supplier of Pharmaceutical machines for different pharmaceutical sections viz. Granulation section, Liquid Section, Ointment Section... დაწვრილებით »
- მინის გადამამუშავებელი დანადგარები | Capsule შევსების მანქანა | შეფუთვის მანქანები | ლაბორატორიული მინის და აღჭურვილობა...
- New Delhi
- ინდოეთი
supplyautonomy.com/relianceenterprise.in
Offering a wide range of Food Processing & Bakery Equipments such as Tomato Ketchup machine, Single Door Deck Oven, Planetary mixer, Spiral mixer, Rotary rack Oven, Tray Dryer, Vacuum Bottle... დაწვრილებით »
- კვების მრეწველობის მოწყობილობები და აღჭურვილობები nes | მანქანა ინსტრუმენტები milling რკინის | შეფუთვის მანქანები | ლაბო...
- Kolkata
- ინდოეთი
supplyautonomy.com/qingdaothinrawoodworkingmachineryfactory.cn
Our company is a professional company which is engaged in designing, manufacturing and selling woodworking machines. Since our establishment in 2009, we have got rapid development and a good... დაწვრილებით »
- ტყავის საწარმოო დანადგარები | ჭრის - ჩარხები | შეფუთვის მანქანები | ხის აღჭურვილობა...
- Qingdao
- ჩინეთი
supplyautonomy.com/problend.bg
We offer :
-constructing, manufacture, service and innovative production solutions for packaging equipment
-constructing, manufacture, service and innovation of non-standard equipment on... დაწვრილებით »
- გენერალური მექანიკური კომპონენტები საფონდო | შეფუთვა და დაფასოება - მანქანები და მოწყობილობა...
- Shumen
- ბულგარეთი
supplyautonomy.com/hondonpackagingfoodmachinerygroup.cn
Paying attention to details, professional service, distinguished quality products and going the extra mile for our customers are the hallmark of Hondon. Supported by own manufacturing plants and... დაწვრილებით »
- შეფუთვა და დაფასოება - მანქანები და მოწყობილობა | შეფუთვის მანქანები...
- Tianjin
- ჩინეთი
supplyautonomy.com/sarongspa.it
SARONG is a private company situated in Reggiolo (RE), in the north of Italy. Founded in 1972 when it brought onto the market the first automatic packaging machine for pharmaceutical suppositories... დაწვრილებით »
- შეფუთვა და დაფასოება - მანქანები და მოწყობილობა | შეფუთვის მანქანები...
- Reggiolo
- იტალია
supplyautonomy.com/dolzanimpiantisrl.it
Vertical packing machines, by weight / volume, with 4 welds, Doypack, vacuum, multi-track and semi-automatic for the food processing, pastry making, chemicals, pharmaceuticals and mechanical sectors.
- შეფუთვა და დაფასოება - მანქანები და მოწყობილობა | კვების მრეწველობა - დანადგარები და აღჭურვილობა...
- Galliera Veneta
- იტალია
supplyautonomy.com/kansanmachineryco.tr
Kansan Machinery Company -today one of the major wet wipes, tissue napkins, toilet papers/towels machines and complete converting lines manufacturers- was established in 1992 as a small workshop. In... დაწვრილებით »
- გადახურვა და overcapping კაფსულები, პლასტიკური | შეფუთვის მანქანები | ჰიგიენის და ტუალეტის პროდუქცია...
- İzmir
- თურქეთი
supplyautonomy.com/sicogaz.fr
- გამოფენა დგას (დაქირავება / გაქირავება) | საგამოფენო დარბაზები (დაქირავება / გაქირავება) | საკონფერენციო (დაქირავება / გ...
- Puteaux
- საფრანგეთი