에 대한 검색 결과 : 화학 및 제약 서비스
발견 549 회사supplyautonomy.com/hrsprocesssystems.in
Manufacturers, Exporters & Importers Of Wide Range Of Heat Exchangers, ECOFLUX* Corrugated Tube Heat Exchanger, Shell And Tube Heat Exchanger, UNICUS® Scraped Surface Heat Exchanger, ... 자세히보기 »
- 생산 서비스,식이 보조제 | 의약품의 혼합 | 의약품의 분무 건조 | 단백질 정제 서비스 | 인간 호르몬의 추출 및 정제 | 혼합 및 화학 산업에 대한 액체의 혼합 | 혼합 및 화학 산업에 대한 고체의 혼합 | 혼합...
- Pune
- 인도
supplyautonomy.com/johnsonmattheyfuelcellslimited.gb
Export Johnson Matthey is a speciality chemicals company focussed on its core skills in precious metals, catalysts and fine chemicals. It is organised into three global divisions: Environmental... 자세히보기 »
- 촉매의 재생 | 활성 탄소 재생 서비스 | 사진 화학 물질의 회수 및 재생 | 복구 및 산업 석유 정제 | 오염 된 용제의 회수 및 재생 | 폐수 및 폐수에서 기름과 지방의 복구 | 천연 및 합성 수지의 회복 | 복...
- London
- 영국
supplyautonomy.com/robinsonwirecloth.gb
Robinson Wire Cloth Ltd are a supplier of all types of filter meshes and materials. Our extensive in-house facilities enable us to manufacture woven mesh screens, tension screens and bonded screens... 자세히보기 »
- 화학 산업에 대한 액체의 체질 | 화학 산업에 대한 고체의 체질 | 화학 산업에 대한 페이스트의 체질 | 가습기, 식사, 식용 식물성 기름 가공 | 히터, 식용 종자 | 수영장 용 염소 발전기 | 식용 종자에 대한 ...
- Stoke On Trent
- 영국
supplyautonomy.com/upgreensas.fr
supplyautonomy.com/sweco.us
- 화학 산업에 대한 고체의 체질 | 가습기, 식사, 식용 식물성 기름 가공 | 히터, 식용 종자 | 식용 종자에 대한 포격 장비 | 조면 기계, 면화 종자 기름 준비 | 건조기, 올리브 잔류 종자 | 프레스, 식용 식...
- Florence
- 미국
supplyautonomy.com/worldwaybiotech.cn
World-Way is specialized in marketing plant-derived extracts and fine chemicals for the nutraceutical, food and cosmetic industries for 15 years. World-Way is founded by Dr. Ginkgo Zeng, Professor in... 자세히보기 »
- 분류 서비스, 정밀 화학 | 정밀 화학 | 다른 정밀 화학 | 추출물
- Changsha
- 중국
supplyautonomy.com/kellyservices.fr
- 기상 컨설턴트 | 스팀 전원 컨설턴트 | 지구 물리학 컨설턴트 | 수문 컨설턴트 | 지하수 개발 컨설턴트 | 유전 공학 컨설턴트 | 미생물학 컨설턴트 | 수의학 컨설턴트 | 인력 채용, 국제 | 임시 도움말 - 국제...
- Clichy
- 프랑스
supplyautonomy.com/sofresidengineering.fr
- 배관 계약자, 화학, 핵 폐기물 시스템 | 배관 설치 업체, 화학 공장 | 배관 설치 계약자, 용광로 및 보일러 | 배관 설치 업체, 기술 가스 생산 공장 | 배관 계약자, 가스 분배 시스템 | 자신의 디자인 시설 ...
- Montigny-le-Bretonneux
- 프랑스
supplyautonomy.com/univar.fr
- 화학 - 수출입 | 단백질 정제 서비스 | 화학 산업에 대한 페이스트의 체질 | 화학 산업 공기 분류 서비스 | 화학 물질의 소성 | 화학 산업에 대한 서비스를 표백 | 응원 화합물 | 오디오 테이프의 마그네틱 산화...
- Fontenay-sous-Bois
- 프랑스
supplyautonomy.com/mediwelllaboratories.in
We are An ISO 9001:2015 , certified and is listed on all Drug updates. Our sister concern are Mediwell wellness , mediwell wellness & Phytomolecules Marcwell Laboratories , All of our... 자세히보기 »
- 화장품 처리 | 약초 | 약초 | 개인 케어 제품 | 남성 케어 | 화장품
- Ambala City
- 인도
supplyautonomy.com/shandongrunkechemicalco.cn
Shandong Runke Chemical Co., Ltd. was established in 2006 and finished holding and restructuring of Weifang Dacheng Salinization Co., Ltd. to the company in 2010. With a registered capital of 40... 자세히보기 »
- 기타 화학 제품 제조 n.e.c. | 화학 제품 | 브롬 고체, 액체 또는 기체
- Weifang
- 중국
supplyautonomy.com/gujaratfluorochemicalslimited.in
Gujarat Fluorochemicals Limited (GFL) is an Indian Chemicals Company with over 30 years of expertise in Fluorine Chemistry. GFL holds domain expertise in Fluoropolymers, Fluorospecialities,... 자세히보기 »
- 화학 물질의 생산 | 화학 제품
- Noida
- 인도
supplyautonomy.com/embelezarkosmetikinstitut.ca
So wie ich mir für meine Haut nur das Beste gönne, lege ich auch in meinem Kosmetikstudio in Frankfurt größten Wert auf die Qualität meiner kosmetischen Produkte und Behandlungen. Als langjährig erfah... 자세히보기 »
- 미용 치료 서비스 | 화장품 처리
- Frankfurt am Main
- 독일
supplyautonomy.com/shandongsunshinechemicaltechnologyco.cn
Shandong Sunshine Chemical Technology Co., Ltd. specializes in R&D, production and management of disinfectant, additives and polymer, and its factory was built in accordance with GMP standards.... 자세히보기 »
- 기타 화학 제품 제조 n.e.c. | 수영장 용 염소 발전기 | 화학 제품 | 화학 물질 및 화학 제품 제조...
- Yanggu
- 중국
supplyautonomy.com/northeastagrochem.cn
Agrochemicals products.
Main products: Malathion, Chlorpyrifos, Thiamethoxam, and others. (Technical and Formulation)
Aгрохимикатов продукции.
Основная продукция: Малатион, Хлорпирифос, Тиаметокса... 자세히보기 »
- 살충제 및 기타 농약 제품 제조 | 농약 | 농약 | 기타 농약 & 살충제 | 농약 및 농약 제품 | 농약 & 살충제...
- Jinxi
- 중국
supplyautonomy.com/chemiplastinternational.pk
Chemiplast International is a strong, family rooted company – founded by a cotton trading veteran Mr. Abid Ali (late) in 1999 with a vision to make Chemiplast one of the leading trading companies ... 자세히보기 »
- 폴리 우레탄 (PU) | 고분자 | 용제 | 기타 화학 제품 제조 | 화학 물질 및 화학 제품 제조
- Karachi
- 파키스탄
supplyautonomy.com/texmor.mx
In 1981, the painting factory Permil S.A. of C.V. I think you will sit in the market of the surest. Our mission is to protect and decorate beautifully designed motifs for the three brothers, written... 자세히보기 »
- 염료 및 안료의 제조 | 페인트, 니스 및 유사 코팅, 인쇄 잉크 및 매 스틱의 제조 | 페인트 및 프라이머...
- Xochitepec
- 멕시코
supplyautonomy.com/varunpolymers.in
Varun Polymers is one of the leading manufacturer and exporter in India, of premium quality recycled rubber products. We manufacture rubber reclaiming agent such as:
1 Di Aryl Di Sulphide
2 ... 자세히보기 »
- 사용자 정 화학 서비스 | 볼 밸브 | 플라스틱 제품 | 접착제 및 테이프 | 주조 된 구성 요소가 융합 한 석영...
- Ahmedabad
- 인도
supplyautonomy.com/lgobbisrl.it
- 생산 서비스,식이 보조제 | 촉매의 재생 | 활성 탄소 재생 서비스 | 사진 화학 물질의 회수 및 재생 | 복구 및 산업 석유 정제 | 오염 된 용제의 회수 및 재생 | 폐수 및 폐수에서 기름과 지방의 복구 | 천연...
- CAMPO LIGURE (GE)
- 이탈리아
supplyautonomy.com/todecasa.es
- 분류 서비스, 정밀 화학 | 화학 물질의 증류 | 음료 산업을위한 효모 | 효모, 빵 굽는 ' | 제과 효모, | 음식, 합성을위한 에센스 | 에센스와 식품 및 음료 산업 추출물 | 캐러멜, 향료 | 식물성 추출물과...
- Barcelona
- 스페인
supplyautonomy.com/eastmanchemicalcompany.us
- 사용자 정 화학 서비스 | 나트륨, 액체 | 나트륨 metabisulphite / 나트륨 pyrosulphite | 나트륨 메톡 / 나트륨 메틸 레이트 | 나트륨 몰리브덴 | 나트륨 메틸 비산 | 질산 나트륨 / 소...
- Kingsport
- 미국
supplyautonomy.com/pelletspharmalimited.in
Manufacturers & Exporters of Sustained / Modified Release Pellets / Micro Granules - Retardstomized Development And Manufacturing Of SR Pellets/Micro Granules-Retard of Various Active... 자세히보기 »
- 의약품의 혼합 | 신경계 장애, 진정제, 안정제, 중국 의학의 준비 | 내분비 장애, 중국어 의학에 대한 준비 | 안과 및 치과, 중국 의학의 준비 | 비뇨기과 및 신장 질환, 중국 의학의 준비 | 염증 준비, 중국...
- Hyderabad
- 인도
supplyautonomy.com/islandwidemarketingservicespvt.lk
Import & Supply of Industrial Chemicals,Machinery Lab Equipment,Packaging along with the Technological Inputs & Clearing & Forwarding Agents,Export of Coconut based... 자세히보기 »
- 복구 및 휘발성 유기 화합물의 재생 (VOC) | 단백질 정제 서비스 | 화학 산업에 대한 액체의 체질 | 화학 산업에 대한 페이스트의 체질 | 화학 산업 공기 분류 서비스 | 화학 제품의 건조 | 화학 물질의 분무...
- Rajagiriya
- 스리랑카
supplyautonomy.com/developpementbernardplasencia.fr
- 의약품 생산 기술 컨설턴트 | 생물 공학 컨설턴트 | 활성 탄소 재생 서비스 | 복구 및 휘발성 유기 화합물의 재생 (VOC) | 단백질 정제 서비스 | 화학 산업에 대한 액체의 체질 | 화학 산업에 대한 페이스트의...
- Saint-Priest
- 프랑스
supplyautonomy.com/aircontrolsa.es
- 냉각 설비, 턴키 프로젝트 | 생산 서비스,식이 보조제 | 의약품의 혼합 | 의약품의 분무 건조 | 단백질 정제 서비스 | 인간 호르몬의 추출 및 정제 | 혼합 및 화학 산업에 대한 액체의 혼합 | 혼합 및 화학 산...
- San Sebastián
- 스페인
supplyautonomy.com/borgessa.es
- 그라우팅, 석고 기반 | 생산 서비스,식이 보조제 | 상품 상인, 원료 고무 및 라텍스 | 상품 상인, 원유 | 의약품의 혼합 | 의약품의 분무 건조 | 단백질 정제 서비스 | 인간 호르몬의 추출 및 정제 | 혼합 ...
- Reus
- 스페인
supplyautonomy.com/crealis.fr
- 관리 상담 | 화학 물질의 증류 | 전기 및 전자 설비를 위해, 제품, 화학 청소 | 데이터 처리 장비, 제품, 화학 제품 청소 | 인쇄 회로 기판 탈지 및 세정 제품 (기판) | 전기 접점에 대한 Deoxidant...
- Bry
- 프랑스
supplyautonomy.com/epiingredients.fr
- 의약품의 혼합 | 화학 산업 페인트 및 안료의 혼합 | 진저 오일 | 분말과 농축 우유 | 음료 산업을위한 효모 | 효모, 빵 굽는 ' | 제과 효모, | 음식에 대한 검정 착색제, | 식품 파란 착색제, | 식품 ...
- Ancenis
- 프랑스
supplyautonomy.com/ktronfrance.fr
- 생산 서비스,식이 보조제 | 서비스, 용제 및 접착제 산업을 채우고 포장 | 의약품의 혼합 | 의약품의 분무 건조 | 단백질 정제 서비스 | 인간 호르몬의 추출 및 정제 | 혼합 및 화학 산업에 대한 액체의 혼합...
- Croissy-sur-Celle
- 프랑스
supplyautonomy.com/hosokawamicronlimited.gb
Hosokawa Micron Ltd is your single source for integrated powder processing systems and containment solutions. Our core products and services include particle design for nano technology, size... 자세히보기 »
- 기술 엔지니어링 컨설턴트를 혼합하고 혼합 | 생산 서비스,식이 보조제 | 의약품의 혼합 | 의약품의 분무 건조 | 단백질 정제 서비스 | 인간 호르몬의 추출 및 정제 | 혼합 및 화학 산업에 대한 액체의 혼합 | 혼...
- Runcorn
- 영국