Loading...
نتائج البحث عن: الطباعة والمعدات الرسومات
الشركات وجدت 277قوائم المفضل المتعلقة بما يلي: الطباعة والمعدات الرسومات
supplyautonomy.com/seniorprintpackmachineryco.in
Manufacturers & Exporters Of Corrugated Board, Box Making Machinery, Corrugated Board Making Plant, Die Punching, Cutting, Creasing & Embossing Machine, Hot Foil Stamping Die Cutting... إقرأ المزيد »
- ماكينة صنع الحقائب | الطباعة والمعدات الرسومات | ﻣﻋﺩﺓ ﻭﺁﻟﺓ ﺗﺻﻧﻳﻓ ﺍﻟﻭﺭﻗ | ﻣﺍﻛﻳﻧﺍﺗ ﻁﺑﻗﻳﻫ ﻟﺗﺣﻭﻳ ﺍﻟﻭﺭﻗ | ﺁﻟﺍﺗ ﻋﺩ ﺍﻟﻭﺭﻗ | ﻣﺍﻛ...
- Hyderabad
- الهند
supplyautonomy.com/cooltechenterprises.in
A renowned name in the domain of Cooling Pads, ABS Ductable Cooling Machine, Desert/Room Coolers, etc., Cool Tech Enterprises has been offering quality to the clients. Combining technology and wide... إقرأ المزيد »
- وكلاء منتجات السلامة | طباعة النقل | ﺧﺩﻣﺍﺗ ﺣﻗﻧ ﺍﻟﻗﻭﺍﻟﺑ ﺍﻟﻣﻋﺩﻧﻳﺓ | مواد العزل | نوابض، تصميم حسب الطلب | وصلات | أنابيب |...
- Amravati
- الهند
supplyautonomy.com/chamundaindustries.in
We are pleased to introduce ourselves as one of the leading Exporters, Manufacturers , Stockists Supplier of stainless steel item,ferrous non-ferrous metal which are required by your company in... إقرأ المزيد »
- وكلاء منتجات السلامة | طباعة النقل | ﺧﺩﻣﺍﺗ ﺣﻗﻧ ﺍﻟﻗﻭﺍﻟﺑ ﺍﻟﻣﻋﺩﻧﻳﺓ | مواد العزل | نوابض، تصميم حسب الطلب | وصلات | أنابيب |...
- Mumbai
- الهند
supplyautonomy.com/hardikenterprises.in
We, Hardik Enterprises, are a customer oriented company involved in the manufacturing & supplying of premium quality industrial fittings. We started our journey in the year 2012, with an... إقرأ المزيد »
- وكلاء منتجات السلامة | طباعة النقل | ﺧﺩﻣﺍﺗ ﺣﻗﻧ ﺍﻟﻗﻭﺍﻟﺑ ﺍﻟﻣﻋﺩﻧﻳﺓ | مواد العزل | نوابض، تصميم حسب الطلب | وصلات | أنابيب |...
- Faridabad
- الهند
supplyautonomy.com/acmemachinerycompany.in
ACME machinery company was established in 1961,
started catering mainly to varied Printing Press and later to Packaging Industry as well, around India. The company built its reputation through... إقرأ المزيد »
- ماكينات الملابس الأخري | الطباعة والمعدات الرسومات | ﻣﺍﻛﻳﻧﺍﺗ ﺻﻧﺍﻋﺓ ﺍﻟﻛﺭﺗﻭﻧ - ﺍﺳﻁﻭﺍﻧﻳﺓ | ﺗﺷﻛﻳﻟﺍﺗ ﻭﻗﻭﺍﻟﺑ ﺩﺍﺋﺭﻳﺓ ﻟﺗﺻﻧﻳﻋ ﺍﻟﻛ...
- Mumbai
- الهند
supplyautonomy.com/ashokenterprise.in
Ashok Enterprise is a reliable firm, known as a trustworthy Trader and Supplier of Garden & Farm Equipment, Engine & Pumpset, Pumps, Generators and Electrical & Control Panels. Our... إقرأ المزيد »
- وكلاء منتجات السلامة | طباعة النقل | ﺧﺩﻣﺍﺗ ﺣﻗﻧ ﺍﻟﻗﻭﺍﻟﺑ ﺍﻟﻣﻋﺩﻧﻳﺓ | مواد العزل | نوابض، تصميم حسب الطلب | وصلات | أنابيب |...
- Bardoli
- الهند
supplyautonomy.com/graphicarbproducts.in
Empowered by experienced professionals who possess sound knowledge of the latest technology, Graphicarb Products has been functioning since 1990. Our company is acknowledged as the leading... إقرأ المزيد »
- وكلاء منتجات السلامة | طباعة النقل | ﺧﺩﻣﺍﺗ ﺣﻗﻧ ﺍﻟﻗﻭﺍﻟﺑ ﺍﻟﻣﻋﺩﻧﻳﺓ | مواد العزل | نوابض، تصميم حسب الطلب | وصلات | أنابيب |...
- Ahmedabad
- الهند
supplyautonomy.com/jitamitraelectroenggpvt.in
An Overview Jitamitra Electro Engg Pvt. Ltd. is a part of ZEN Group, which was established in 1993. Operating from a state-of-the-art infrastructural setup at Ahmednagar (Maharashtra), the company is... إقرأ المزيد »
- وكلاء منتجات السلامة | طباعة النقل | ﺧﺩﻣﺍﺗ ﺣﻗﻧ ﺍﻟﻗﻭﺍﻟﺑ ﺍﻟﻣﻋﺩﻧﻳﺓ | مواد العزل | نوابض، تصميم حسب الطلب | وصلات | أنابيب |...
- Pune
- الهند
supplyautonomy.com/marutienterprise11.in
We, Maruti Enterprise, are working as a prominent Manufacturer and Supplier of Packaging Trays, Food Packaging Trays, Meal Packaging Trays, Blister Forming Packaging, Blister Packaging Tray, Cake... إقرأ المزيد »
- وكلاء منتجات السلامة | طباعة النقل | ﺧﺩﻣﺍﺗ ﺣﻗﻧ ﺍﻟﻗﻭﺍﻟﺑ ﺍﻟﻣﻋﺩﻧﻳﺓ | مواد العزل | نوابض، تصميم حسب الطلب | وصلات | أنابيب |...
- Kalol
- الهند
supplyautonomy.com/akshardhamindustries.in
Manufacturer and Exporters of Multi Colour Gravure Printing Press, Lamination and Slitting Machines.
- الطباعة والمعدات الرسومات | ﺁﻟﺍﺗ، ﻁﺑﺍﻋﺓ ﺍﺳﻁﻭﺍﻧﻳﻫ ﺫﺍﺗ ﺳﺭﻋﺓ ﺩﻭﺭﺍﻧ ﺃﺣﺍﺩﻳﺓ | ﺁﻟﺍﺗ، ﻁﺑﺍﻋﺓ ﺍﺳﻁﻭﺍﻧﻳﻫ ﺫﺍﺗ ﺳﺭﻋﺓ ﺩﻭﺭﺍﻧ ﺛﻧﺍﺋﻳﻫ | ﺁﻟ...
- Wadhwan
- الهند
supplyautonomy.com/angelindiacadcampvt.in
Manufacturer, Exporters & Importers of Cutting Plotters, Laser Engravers, Laser Market, CNC Router, Fiber Laser, Laser Welder, Inkjet Printers, Solvent Printer and All kinds of Ink for... إقرأ المزيد »
- حقائب | ﺁﻟﺍﺗ ﺍﻟﻫﺑﺧﻳﺭ ﺍﻟﺭﻁﺑ / ﻟﻟﻧﺳﻳﺟ | ﺁﻟﺍﺗ ﺍﻟﻫﺑﺧﻳﺭ ﺍﻟﺟﺍﻓ، ﻟﻟﻧﺳﻳﺟ | ﺃﺟﻫﺯﺓ ﺑﺧﺍﺭ ﺫﺍﺗ ﺿﻏﻁ ﻣﻧﺧﻓﺿ ﻟﻟﻧﺳﻳﺟ | ﺻﻧﺍﺩﻳﻗ ﺗﺑﺧﻳﺭ، ﻟﻟﻧﺳﻳ...
- New Delhi
- الهند
supplyautonomy.com/gurusalescorporation.in
With extensive industry experience and in-depth knowledge, we, Guru Sales Corporation have established ourselves among the leading suppliers and service providers of high quality Granite Tiles, Solar... إقرأ المزيد »
- وكلاء منتجات السلامة | طباعة النقل | ﺧﺩﻣﺍﺗ ﺣﻗﻧ ﺍﻟﻗﻭﺍﻟﺑ ﺍﻟﻣﻋﺩﻧﻳﺓ | مواد العزل | نوابض، تصميم حسب الطلب | وصلات | أنابيب |...
- Ilkal
- الهند
supplyautonomy.com/gehlotworks.in
Manufacturers and Exporters of Flexo Graphic and Roto-Gravure Printing Machines.
- ﻣﺳﺗﻭﺭﻭﺩﻭﻧ/ﻣﺻﺩﺭﻭﻧ، ﺍﻟﻭﺭﻗ | ورق تواليت | ﻣﻧﺍﺩﻳﻟ ﻭﺭﻗﻳﺓ ﻟﻟﻭﺟﻫ ﻭﺣﺷﻭ ﺍﻟﺳﻳﻟﻳﻭﺯ | ﻣﻧﺍﺩﻳﻟ ﻭﺭﻗﻳﺓ ﻟﻟﺣﻣﺍﻣ ﻣﺭﻁﺑﺓ | ﻭﺭﻗ ﻧﺷﺍﻓ, ﺻﻧﺍﻋﻳ, ﺍ...
- Jodhpur
- الهند
supplyautonomy.com/laxmiudyog.in
- وكلاء منتجات السلامة | طباعة النقل | ﺧﺩﻣﺍﺗ ﺣﻗﻧ ﺍﻟﻗﻭﺍﻟﺑ ﺍﻟﻣﻋﺩﻧﻳﺓ | مواد العزل | نوابض، تصميم حسب الطلب | وصلات | أنابيب |...
- Mumbai
- الهند
supplyautonomy.com/engineersudyog.in
With extensive technical expertise and a well maintained infrastructure, we, Modern Industries, have carved an eminent position in the competitive market. We are reckoned as a prominent manufacturer,... إقرأ المزيد »
- وصلات | الكرة الصمامات | فراشة الصمامات | ﺳﻳﻭﺭ ﻟﻟﻧﻗﻟ ﻣﻧ ﺃﻟﻳﺍﻓ ﺃﺳﻣﻧﺗﻳﻫ | ﻣﻧﺗﺟﺍﺗ ﺃﻟﻳﺍﻓ ﺃﺳﻣﻧﺗﻳﺓ ﻣﻗﺍﻭﻣﺓ ﻟﻟﺣﺭﻳﻗ | الطباعة وال...
- Howrah
- الهند
supplyautonomy.com/lineomaticgraphicindustries.in
Welcome to the world of precision perfection. commitment assurance. innovation excellence. quality and originality.
Line O Matic Graphic Industries has always been a precursor in introducing... إقرأ المزيد »
- الطباعة والمعدات الرسومات | ماكينات تجهيز الأوراق | الطابعات والمجلدات...
- Ahmedabad
- الهند
supplyautonomy.com/wenzhouduke.cn
Wenzhou Duke Import Export Co., ltd is Located in the Ruian city .We specialized in supplying plastic production machine,auto parts,shopping bags and so on ,especially the brake pads and film... إقرأ المزيد »
- فيلم تمديد | الطباعة والمعدات الرسومات | آلات التعبئة والتغليف
- Wenzhou
- الصين
supplyautonomy.com/cangzhoutongbaocartonmachineryco.cn
Our corporation specializes in the development and production of cardboard machinery in Northern China. There are 280 employees in our corporation now and 68 staff members specialize in scientific... إقرأ المزيد »
- الطباعة والمعدات الرسومات | ماكينات تجهيز الأوراق | أدوات آلة لطحن المعادن...
- Cangzhou
- الصين
supplyautonomy.com/vicstarmachinerygroup.cn
Shenzhen Vicstar Imp. Exp. Co., Ltd. is specialized in manufacturing of packaging and printing machines, as one of the backbone enterprises in packaging and printing industries in China.
Our... إقرأ المزيد »
- الطباعة والمعدات الرسومات | معدات ليزر
- Shenzhen
- الصين
supplyautonomy.com/taixinglianbangprintingproductsco.cn
PS and CTP Plate is the most comprehensive applied offset plate in the printing industry,China has been developed into a world manufacture plant of offset plate.LianBang Printing Products Co.,Ltd... إقرأ المزيد »
- معدات التنظيف | الطباعة والمعدات الرسومات
- Taixing
- الصين
supplyautonomy.com/ruianweiguoprintingpackagingmachineryfactory.cn
Wenzhou Qiangtuo Machinery Co., Ltd. (Ruian Weiguo Machinery Pakage Factory) is a professional manufacturer of printing machines, film-blowing machines, bag-making machines, slitting machines and... إقرأ المزيد »
- الطباعة والمعدات الرسومات | معدات مناولة المواد الأخري
- Wenzhou
- الصين
supplyautonomy.com/ruianwanyuanpackingmachineco.cn
We are a manufacturer of non woven bag-making machines with well-equipped testing equipment and strong technical force. With a wide range, good quality, reasonable prices and stylish designs, our... إقرأ المزيد »
- ماكينة صنع الحقائب | الطباعة والمعدات الرسومات
- Ruian
- الصين
supplyautonomy.com/ruianlishengprintingpackagingmachineryco.cn
Ruian Lisheng Prining Packing Machinery Factory is an enterprise producing complete sets of plastic soft packing and paper packing equipment. Taking science and technology as support, customer... إقرأ المزيد »
- ماكينة صنع الحقائب | الطباعة والمعدات الرسومات
- Ruian
- الصين
supplyautonomy.com/ruianjiangnanmachineryco.cn
As high quality needs of lifr today,beautifully packaged required by everything.Ruian ZHEREN Printing Machine Co,.Ltd.were set up,located in the East China Sea,"Ruian City"
ZHEREN... إقرأ المزيد »
- ماكينة صنع الحقائب | الطباعة والمعدات الرسومات
- Ruian
- الصين
supplyautonomy.com/cheungwohingprintingmachineryco.cn
Established in 1995, Cheung Wo Hing Printing Machinery Co., Ltd. (CWH) is a large-scale company based on Hong Kong capital. We concentrate on the RD, manufacturing, and marketing of professional... إقرأ المزيد »
- الطباعة والمعدات الرسومات | ماكينات صنع المنتجات الورقية
- Dongguan
- الصين
supplyautonomy.com/wenzhouounuopackingmachineryco.cn
Wenzhou Ounuo Machinery Co., Ltd. is a professional manufacturer of fully automatic non-woven bag making machines, Paper cup machine,Non woven Screen printing Machine,Nonwoven printing machines,... إقرأ المزيد »
- أكياس وحقائب | آلات الخياطة | الطباعة والمعدات الرسومات | آلات التعبئة والتغليف...
- Wenzhou
- الصين
supplyautonomy.com/ntexengineeringworkspvt.in
N-TEX Group focuses on productivity, providing flexible solutions wherever resources, performance and interaction requirements permit. By translating a deep understanding of our customers'... إقرأ المزيد »
- ماكينات النسيج الأخري | الطباعة والمعدات الرسومات
- Ahmedabad
- الهند
supplyautonomy.com/xlplastics.in
We are pleased to Introduce ourselves and it would not be out of place to say that we are one of the leading manufacturers of Plastic Film converting machinery in the Asian Sub Continent. We have... إقرأ المزيد »
- ماكينة صنع الحقائب | الطباعة والمعدات الرسومات | آلات التعبئة والتغليف...
- Vadodara
- الهند
supplyautonomy.com/krishnaengineeringworks6.in
We are pleased to introduce ourselves as one of the leading manufacturers of Plastic Packaging, Paper Converting, Textile Processing Tyre Cord machineries from India. Please visit us at WWW.... إقرأ المزيد »
- آلات النسيج التشطيب | الطباعة والمعدات الرسومات | آلات التعبئة والتغليف...
- Ahmedabad
- الهند
supplyautonomy.com/jayomaindustries.in
JAYOMA INDUSTRIES is Manufacturers and Exporter of Textile Screen Both Of Rotary And Flat screen Machinery and Spares. And Also Manufacturing Flexo Plate making Equipments. JAYOMA is Established in... إقرأ المزيد »
- الطباعة والمعدات الرسومات | حقائب الاسمنت | أجهزة كهربية و إلكترونية (تجارة)...
- Ahmedabad
- الهند