Resultater for: Produksjon av kjemikalier og kjemiske produkter
Fant 489 selskaperRelaterte kategorier
supplyautonomy.com/mediwelllaboratories.in
We are An ISO 9001:2015 , certified and is listed on all Drug updates. Our sister concern are Mediwell wellness , mediwell wellness & Phytomolecules Marcwell Laboratories , All of our... Les mer »
- Kosmetikkfremstilling | Urtemedisin | Urtemedisiner | Personlig pleie-produkter | Menn omsorg | Kosmetikk
- Ambala City
- India
supplyautonomy.com/sofresidengineering.fr
- Rørinstallasjoner, spillvannssystemer til kjemiske og kjernefysiske anlegg | Rørinstallasjoner for kjemiske anlegg | R...
- Montigny-le-Bretonneux
- Frankrike
supplyautonomy.com/sweco.us
- Sikting av faste stoffer, for kjemisk industri | Melfuktere, for produksjon av vegetabilsk matolje | Varmere for...
- Florence
- USA
supplyautonomy.com/sudarshandhoopp.in
Manufacturers and Exporters of Incense Products like Dhoop, Agarbathi Coils and Cones, Extruded Bambooless Sticks, Incense Sticks, Magical Charcoal Tablets, Pure Natural Agarbatti, Incense Gift Sets... Les mer »
- Produksjon av kosttilskudd | Fylling og pakking, løsemidler og limprodukter, for industribruk | Blanding av ...
- New Delhi
- India
supplyautonomy.com/gujaratfluorochemicalslimited.in
Gujarat Fluorochemicals Limited (GFL) is an Indian Chemicals Company with over 30 years of expertise in Fluorine Chemistry. GFL holds domain expertise in Fluoropolymers, Fluorospecialities,... Les mer »
- Produksjon av kjemikalier | Kjemikalier
- Noida
- India
supplyautonomy.com/texmor.mx
In 1981, the painting factory Permil S.A. of C.V. I think you will sit in the market of the surest. Our mission is to protect and decorate beautifully designed motifs for the three brothers, written... Les mer »
- Produksjon av fargestoffer og pigmenter | Produksjon av maling og lakk, trykkfarger og tetningsmidler | Maling og...
- Xochitepec
- Mexico
supplyautonomy.com/embelezarkosmetikinstitut.ca
So wie ich mir für meine Haut nur das Beste gönne, lege ich auch in meinem Kosmetikstudio in Frankfurt größten Wert auf die Qualität meiner kosmetischen Produkte und Behandlungen. Als langjährig erfah... Les mer »
- Kosmetisk behandling | Kosmetikkfremstilling
- Frankfurt am Main
- Tyskland
supplyautonomy.com/shandongrunkechemicalco.cn
Shandong Runke Chemical Co., Ltd. was established in 2006 and finished holding and restructuring of Weifang Dacheng Salinization Co., Ltd. to the company in 2010. With a registered capital of 40... Les mer »
- Produksjon av kjemiske produkter ikke nevnt annet sted | Kjemikalier og kjemiske produkter | Brom, fast, flytende eller...
- Weifang
- Kina
supplyautonomy.com/shandongsunshinechemicaltechnologyco.cn
Shandong Sunshine Chemical Technology Co., Ltd. specializes in R&D, production and management of disinfectant, additives and polymer, and its factory was built in accordance with GMP standards.... Les mer »
- Produksjon av kjemiske produkter ikke nevnt annet sted | Klorgeneratorer for svømmebasseng | Kjemikalier og kjemiske ...
- Yanggu
- Kina
supplyautonomy.com/northeastagrochem.cn
Agrochemicals products.
Main products: Malathion, Chlorpyrifos, Thiamethoxam, and others. (Technical and Formulation)
Aгрохимикатов продукции.
Основная продукция: Малатион, Хлорпирифос, Тиаметокса... Les mer »
- Produksjon av plantevern- og skadedyrmidler og andre landbrukskjemiske produkter | Landbrukskjemikalier | Agrokjemisk |...
- Jinxi
- Kina
supplyautonomy.com/chemiplastinternational.pk
Chemiplast International is a strong, family rooted company – founded by a cotton trading veteran Mr. Abid Ali (late) in 1999 with a vision to make Chemiplast one of the leading trading companies ... Les mer »
- Polyuretan (PUR) | Polymerer | Løsemidler | Produksjon av andre kjemiske produkter | Produksjon av kjemikalier og ...
- Karachi
- Pakistan
supplyautonomy.com/varunpolymers.in
Varun Polymers is one of the leading manufacturer and exporter in India, of premium quality recycled rubber products. We manufacture rubber reclaiming agent such as:
1 Di Aryl Di Sulphide
2 ... Les mer »
- Custom kjemiske tjenester | Kuleventiler | Plastprodukter | Lim og tape | Formdeler, smeltet kvarts
- Ahmedabad
- India
supplyautonomy.com/todecasa.es
- Klassifisering av rene kjemikalier | Destillering av kjemikalier | Gjær til drikkevareindustrien | Gjær til bakerier | G...
- Barcelona
- Spania
supplyautonomy.com/eastmanchemicalcompany.us
- Custom kjemiske tjenester | Natrium, flytende | Natriummetabisulfitt (natriumpyrosulfitt) | Natriummetoksid |...
- Kingsport
- USA
supplyautonomy.com/lgobbisrl.it
- Produksjon av kosttilskudd | Regenerering av katalysatorer | Regenerering av aktivt karbon | Gjenvinning og...
- CAMPO LIGURE (GE)
- Italia
supplyautonomy.com/stridesarcolab.in
Manufacturer, Exporters and Importers of Antibiotics, Cephalophins, Nutracentieah, HIV Rearoviral, Vitamins, Soft Gelatin Capsule, Tablet, Liquid Injection, Dry Powder Injection, Oral Solid Dosage... Les mer »
- Produksjon av kosttilskudd | Blanding av farmasøytiske produkter | Spraytørking av farmasøytiske produkter | Rensing av ...
- Bengaluru
- India
supplyautonomy.com/islandwidemarketingservicespvt.lk
Import & Supply of Industrial Chemicals,Machinery Lab Equipment,Packaging along with the Technological Inputs & Clearing & Forwarding Agents,Export of Coconut based... Les mer »
- Gjenvinning av flyktige organiske forbindelser | Rensing av proteiner | Sikting av væske, for kjemisk industri | ...
- Rajagiriya
- Sri Lanka
supplyautonomy.com/developpementbernardplasencia.fr
- Farmasøytisk produksjon, rådgivende ingeniører | Biokjemiteknikk, rådgivende ingeniører | Regenerering av aktivt karbon ...
- Saint-Priest
- Frankrike
supplyautonomy.com/aircontrolsa.es
- Kjøleanlegg, nøkkelferdige prosjekter | Produksjon av kosttilskudd | Blanding av farmasøytiske produkter | Spraytørking ...
- San Sebastián
- Spania
supplyautonomy.com/borgessa.es
- Innfyllingspuss, gipsbasert | Produksjon av kosttilskudd | Råvarehandlere, rågummi og lateks | Råvarehandlere, råolje | ...
- Reus
- Spania
supplyautonomy.com/crealis.fr
- Bedriftsledelse - råd | Destillering av kjemikalier | Rensemidler, kjemiske, for elektriske og elektroniske ...
- Bry
- Frankrike
supplyautonomy.com/novissrl.it
- Syntetisering, kjemisk | Fargende kjemikalier for metall | Kjemikalier for kromplettering | Tilsetningsstoffer,...
- Calenzano
- Italia
supplyautonomy.com/azelisfrance.fr
- Produksjon av kosttilskudd | Kjemi - import/eksport | Blanding av farmasøytiske produkter | Spraytørking av f...
- Paris
- Frankrike
supplyautonomy.com/epiingredients.fr
- Blanding av farmasøytiske produkter | Blanding av maling og pigmenter, for kjemisk industri | Ingefær olje | Tørrmelk og...
- Ancenis
- Frankrike
supplyautonomy.com/ktronfrance.fr
- Produksjon av kosttilskudd | Fylling og pakking, løsemidler og limprodukter, for industribruk | Blanding av ...
- Croissy-sur-Celle
- Frankrike
supplyautonomy.com/hosokawamicronlimited.gb
Hosokawa Micron Ltd is your single source for integrated powder processing systems and containment solutions. Our core products and services include particle design for nano technology, size... Les mer »
- Blandeteknologi, rådgivende ingeniører | Produksjon av kosttilskudd | Blanding av farmasøytiske produkter | Sp...
- Runcorn
- Storbritannia
supplyautonomy.com/ajantachemicals.in
Manufacturers and Exporters of Agro Chemicals, Organic Chemicals and Inorganic Chemicals.
- Produksjon av kosttilskudd | Blanding av farmasøytiske produkter | Spraytørking av farmasøytiske produkter | Rensing av ...
- New Delhi
- India
supplyautonomy.com/standardplasticatehnicsrl.ro
- Anlegg og utstyr for pakking og fylling, rådgivende ingeniører | Anlegg for trykte kretser og o...
- Bucuresti
- Romania
supplyautonomy.com/swecoeuropedivisionfrance.fr
- Sikting av væske, for kjemisk industri | Sikting av faste stoffer, for kjemisk industri | Sikting av pasta, for kjemisk ...
- VALENCIENNES
- Frankrike
supplyautonomy.com/chemineerlimited.gb
- Blanding av pasta, for kjemisk industri | Blandere for sprengstoffproduksjon | Tørkeutstyr for eksplosiver | ...
- Derby
- Storbritannia