Loading...
Search Results for: Percetakan dan peralatan grafis
Perusahaan 277 DitemukanDaftar pilihan yang terkait dengan: Percetakan dan peralatan grafis
supplyautonomy.com/seniorprintpackmachineryco.in
Manufacturers & Exporters Of Corrugated Board, Box Making Machinery, Corrugated Board Making Plant, Die Punching, Cutting, Creasing & Embossing Machine, Hot Foil Stamping Die Cutting... Read More »
- Tas membuat mesin | Percetakan dan peralatan grafis | Mesin sortasi kertas dan peralatan | Peletakan mesin (layboys),...
- Hyderabad
- India
supplyautonomy.com/cooltechenterprises.in
A renowned name in the domain of Cooling Pads, ABS Ductable Cooling Machine, Desert/Room Coolers, etc., Cool Tech Enterprises has been offering quality to the clients. Combining technology and wide... Read More »
- Agen keamanan produk | Pencetakan transfer | Injection molding jasa, logam | Bahan isolasi | Kustom desain springs |...
- Amravati
- India
supplyautonomy.com/chamundaindustries.in
We are pleased to introduce ourselves as one of the leading Exporters, Manufacturers , Stockists Supplier of stainless steel item,ferrous non-ferrous metal which are required by your company in... Read More »
- Agen keamanan produk | Pencetakan transfer | Injection molding jasa, logam | Bahan isolasi | Kustom desain springs |...
- Mumbai
- India
supplyautonomy.com/hardikenterprises.in
We, Hardik Enterprises, are a customer oriented company involved in the manufacturing & supplying of premium quality industrial fittings. We started our journey in the year 2012, with an... Read More »
- Agen keamanan produk | Pencetakan transfer | Injection molding jasa, logam | Bahan isolasi | Kustom desain springs |...
- Faridabad
- India
supplyautonomy.com/acmemachinerycompany.in
ACME machinery company was established in 1961,
started catering mainly to varied Printing Press and later to Packaging Industry as well, around India. The company built its reputation through... Read More »
- Mesin pakaian lainnya | Percetakan dan peralatan grafis | Mesin pembuatan kardus, terus menerus, silinder | Cetakan,...
- Mumbai
- India
supplyautonomy.com/ashokenterprise.in
Ashok Enterprise is a reliable firm, known as a trustworthy Trader and Supplier of Garden & Farm Equipment, Engine & Pumpset, Pumps, Generators and Electrical & Control Panels. Our... Read More »
- Agen keamanan produk | Pencetakan transfer | Injection molding jasa, logam | Bahan isolasi | Kustom desain springs |...
- Bardoli
- India
supplyautonomy.com/graphicarbproducts.in
Empowered by experienced professionals who possess sound knowledge of the latest technology, Graphicarb Products has been functioning since 1990. Our company is acknowledged as the leading... Read More »
- Agen keamanan produk | Pencetakan transfer | Injection molding jasa, logam | Bahan isolasi | Kustom desain springs |...
- Ahmedabad
- India
supplyautonomy.com/jitamitraelectroenggpvt.in
An Overview Jitamitra Electro Engg Pvt. Ltd. is a part of ZEN Group, which was established in 1993. Operating from a state-of-the-art infrastructural setup at Ahmednagar (Maharashtra), the company is... Read More »
- Agen keamanan produk | Pencetakan transfer | Injection molding jasa, logam | Bahan isolasi | Kustom desain springs |...
- Pune
- India
supplyautonomy.com/marutienterprise11.in
We, Maruti Enterprise, are working as a prominent Manufacturer and Supplier of Packaging Trays, Food Packaging Trays, Meal Packaging Trays, Blister Forming Packaging, Blister Packaging Tray, Cake... Read More »
- Agen keamanan produk | Pencetakan transfer | Injection molding jasa, logam | Bahan isolasi | Kustom desain springs |...
- Kalol
- India
supplyautonomy.com/akshardhamindustries.in
Manufacturer and Exporters of Multi Colour Gravure Printing Press, Lamination and Slitting Machines.
- Percetakan dan peralatan grafis | Percetakan, silinder, single-revolusi | Percetakan, silinder, dua-revolusi |...
- Wadhwan
- India
supplyautonomy.com/angelindiacadcampvt.in
Manufacturer, Exporters & Importers of Cutting Plotters, Laser Engravers, Laser Market, CNC Router, Fiber Laser, Laser Welder, Inkjet Printers, Solvent Printer and All kinds of Ink for... Read More »
- Tas | Mesin uap basah, tekstil | Kering mesin uap, tekstil | Mengukus peralatan, tekanan rendah, tekstil | Mengukus...
- New Delhi
- India
supplyautonomy.com/gurusalescorporation.in
With extensive industry experience and in-depth knowledge, we, Guru Sales Corporation have established ourselves among the leading suppliers and service providers of high quality Granite Tiles, Solar... Read More »
- Agen keamanan produk | Pencetakan transfer | Injection molding jasa, logam | Bahan isolasi | Kustom desain springs |...
- Ilkal
- India
supplyautonomy.com/gehlotworks.in
Manufacturers and Exporters of Flexo Graphic and Roto-Gravure Printing Machines.
- Importir-eksportir, kertas | Tisu toilet | Popok, sapu tangan dan wajah jaringan, gumpalan selulosa | Kertas toilet,...
- Jodhpur
- India
supplyautonomy.com/laxmiudyog.in
- Agen keamanan produk | Pencetakan transfer | Injection molding jasa, logam | Bahan isolasi | Kustom desain springs |...
- Mumbai
- India
supplyautonomy.com/engineersudyog.in
With extensive technical expertise and a well maintained infrastructure, we, Modern Industries, have carved an eminent position in the competitive market. We are reckoned as a prominent manufacturer,... Read More »
- Kopling | Katup bola | Katup kupu-kupu | Ban berjalan, fiber semen | Produk semen Serat, tahan api | Percetakan dan...
- Howrah
- India
supplyautonomy.com/lineomaticgraphicindustries.in
Welcome to the world of precision perfection. commitment assurance. innovation excellence. quality and originality.
Line O Matic Graphic Industries has always been a precursor in introducing... Read More »
- Percetakan dan peralatan grafis | Mesin pengolahan Kertas | Printer & pengikat
- Ahmedabad
- India
supplyautonomy.com/wenzhouduke.cn
Wenzhou Duke Import Export Co., ltd is Located in the Ruian city .We specialized in supplying plastic production machine,auto parts,shopping bags and so on ,especially the brake pads and film... Read More »
- Stretch film | Percetakan dan peralatan grafis | Mesin kemasan
- Wenzhou
- China
supplyautonomy.com/cangzhoutongbaocartonmachineryco.cn
Our corporation specializes in the development and production of cardboard machinery in Northern China. There are 280 employees in our corporation now and 68 staff members specialize in scientific... Read More »
- Percetakan dan peralatan grafis | Mesin pengolahan Kertas | Peralatan mesin untuk logam penggilingan
- Cangzhou
- China
supplyautonomy.com/vicstarmachinerygroup.cn
Shenzhen Vicstar Imp. Exp. Co., Ltd. is specialized in manufacturing of packaging and printing machines, as one of the backbone enterprises in packaging and printing industries in China.
Our... Read More »
- Percetakan dan peralatan grafis | Laser peralatan
- Shenzhen
- China
supplyautonomy.com/taixinglianbangprintingproductsco.cn
PS and CTP Plate is the most comprehensive applied offset plate in the printing industry,China has been developed into a world manufacture plant of offset plate.LianBang Printing Products Co.,Ltd... Read More »
- Membersihkan peralatan | Percetakan dan peralatan grafis
- Taixing
- China
supplyautonomy.com/ruianweiguoprintingpackagingmachineryfactory.cn
Wenzhou Qiangtuo Machinery Co., Ltd. (Ruian Weiguo Machinery Pakage Factory) is a professional manufacturer of printing machines, film-blowing machines, bag-making machines, slitting machines and... Read More »
- Percetakan dan peralatan grafis | Peralatan penanganan material lainnya
- Wenzhou
- China
supplyautonomy.com/ruianwanyuanpackingmachineco.cn
We are a manufacturer of non woven bag-making machines with well-equipped testing equipment and strong technical force. With a wide range, good quality, reasonable prices and stylish designs, our... Read More »
- Tas membuat mesin | Percetakan dan peralatan grafis
- Ruian
- China
supplyautonomy.com/ruianlishengprintingpackagingmachineryco.cn
Ruian Lisheng Prining Packing Machinery Factory is an enterprise producing complete sets of plastic soft packing and paper packing equipment. Taking science and technology as support, customer... Read More »
- Tas membuat mesin | Percetakan dan peralatan grafis
- Ruian
- China
supplyautonomy.com/ruianjiangnanmachineryco.cn
As high quality needs of lifr today,beautifully packaged required by everything.Ruian ZHEREN Printing Machine Co,.Ltd.were set up,located in the East China Sea,"Ruian City"
ZHEREN... Read More »
- Tas membuat mesin | Percetakan dan peralatan grafis
- Ruian
- China
supplyautonomy.com/cheungwohingprintingmachineryco.cn
Established in 1995, Cheung Wo Hing Printing Machinery Co., Ltd. (CWH) is a large-scale company based on Hong Kong capital. We concentrate on the RD, manufacturing, and marketing of professional... Read More »
- Percetakan dan peralatan grafis | Produk kertas membuat mesin
- Dongguan
- China
supplyautonomy.com/wenzhouounuopackingmachineryco.cn
Wenzhou Ounuo Machinery Co., Ltd. is a professional manufacturer of fully automatic non-woven bag making machines, Paper cup machine,Non woven Screen printing Machine,Nonwoven printing machines,... Read More »
- Kantong dan karung | Mesin jahit | Percetakan dan peralatan grafis | Mesin kemasan
- Wenzhou
- China
supplyautonomy.com/ntexengineeringworkspvt.in
N-TEX Group focuses on productivity, providing flexible solutions wherever resources, performance and interaction requirements permit. By translating a deep understanding of our customers'... Read More »
- Mesin tekstil lainnya | Percetakan dan peralatan grafis
- Ahmedabad
- India
supplyautonomy.com/xlplastics.in
We are pleased to Introduce ourselves and it would not be out of place to say that we are one of the leading manufacturers of Plastic Film converting machinery in the Asian Sub Continent. We have... Read More »
- Tas membuat mesin | Percetakan dan peralatan grafis | Mesin kemasan
- Vadodara
- India
supplyautonomy.com/krishnaengineeringworks6.in
We are pleased to introduce ourselves as one of the leading manufacturers of Plastic Packaging, Paper Converting, Textile Processing Tyre Cord machineries from India. Please visit us at WWW.... Read More »
- Mesin tekstil-finishing | Percetakan dan peralatan grafis | Mesin kemasan
- Ahmedabad
- India
supplyautonomy.com/jayomaindustries.in
JAYOMA INDUSTRIES is Manufacturers and Exporter of Textile Screen Both Of Rotary And Flat screen Machinery and Spares. And Also Manufacturing Flexo Plate making Equipments. JAYOMA is Established in... Read More »
- Percetakan dan peralatan grafis | Kantong semen | Peralatan listrik dan elektronik
- Ahmedabad
- India