에 대한 검색 결과 : 포장 기계
발견 4346 회사supplyautonomy.com/trustarpharmapackingequipment.cn
Wenzhou Trustar Machinery Technology co.,ltd.is located in Ruian, Wenzhou, the capital of packaging and printing. The factory covers an area of about 7000 square meters and the office building area... 자세히보기 »
- 포장 기계
- Wenzhou
- 중국
supplyautonomy.com/tangshankingvidaprintingmachineryco.cn
The outstanding Tangshan Kingvida Printing Machinery Co., Ltd. is a professional manufacturer of printing and packaging machinery. Located in the central area of Beijing,Tianjin and Tangshan.The... 자세히보기 »
- 종이 절단 - 기계 및 장비 | 포장 기계 | 판지는 기계를 접고 붙인
- Yutian County
- 중국
supplyautonomy.com/zhejiangruianyongtaipackingmachinerymanufactureco.cn
Zhejiang Ruian Yongtai Packing Machinery Manufacture Co., Ltd is specialized in producing complete sets of flexible packaging equipment and has a long history. We specially produce various plastic... 자세히보기 »
- 가방 기계 만들기 | 가방 기계 부품 생산 | 인쇄 기계 | 골판지 포장은 기계를 만드는 | 포장 기계 | 포장 기계 | 도매 포장 기계 | 가방 만드는 기계...
- Wenzhou
- 중국
supplyautonomy.com/guangdongqishengmachineryco.cn
supplyautonomy.com/lindumpackaging1.gb
We analyse what constraints are preventing our customers from achieving optimum efficiency. We know that they need the right products, in the right place, at the right time.
Production Can’t Stop ... 자세히보기 »
- 포장 연구 컨설턴트 | 포장 및 포장 재료의 시험 | 포장 서비스 | 케이스와 가슴 - 맞춤 포장 | 산업 포장 | 접착제 및 접착 테이프와 롤 | 플라스틱 팔레트 커버와 라이너, | 박스 | 기계의 포장 | 포장 ...
- Stallingborough, North East Lincolnshire
- 영국
supplyautonomy.com/soonkpackagingmachine.cn
Foshan Soonk Packaging Machine Co., Ltd. is a professional advanced enterprise engaged in packaging machine research and development, design, production, sales and maintenance.
- 포장 기계 및 장비, 중고 | 씰링 및 포장 - 기계 및 장비 | 포장 및 포장 - 기계 및 장비 | 포장 바다 표범 어업 기계 | 포장 기계 및 장비 | 포장 기계 | 성형 기계를 포장 | 다기능 포장기 | 포장 ...
- Foshan
- 중국
supplyautonomy.com/tubitexspa.it
supplyautonomy.com/antoniodominicifratellicostruzionimeccanichesrl.it
Production of machinery for the baking and food industries. Robotized systems for handling, chocolate egg wrappers, chocolate coin wrappers, nougat cookers and cutters, bakery machinery, automatic... 자세히보기 »
- 빵 및 과자 결정을위한 기계 반죽 | 제과 기계 및 장비 반죽 및 혼합 | 제과 성형 설비 및 장비, | 제과 압출 공장, | 제과 입금 식물, | 과자, 뜨거운 및 테이블 감기 | 오븐, 제과 | 제과 코팅 기계 ...
- Perugia
- 이탈리아
supplyautonomy.com/bidllc.ua
BID company - Pasta and packaging equipment manufacture
Dear Sirs!
The distinctive mark of our company is a wide range of pasta, drying and packaging equipment, which allows to produce pasta... 자세히보기 »
- 빵 및 과자 결정을위한 기계 반죽 | 식품 산업 플랜트 및 장비 NES | 기계 재고 | 포장 및 포장 - 기계 및 장비 | 포장 기계 | 파이 만들기 - 기계 및 장비 | 식품 산업 - 기계 및 장비 | 건조기, ...
- Dnepropetrovsk
- 우크라이나
supplyautonomy.com/rakshapackaging.in
The company formed in the year 1976 as a-class ancillary suppliers diversified into the field of packaging by the name of Raksha Packaging in the year 1994.
The growth in packaging industry is far... 자세히보기 »
- 피자 배달을위한 캐리어, 플라스틱, | 식품 용 필름, 플라스틱, | 식품 용 부대, 플라스틱, | 와인과 맥주 컨테이너, 합성, | 패킷은 식품 산업을위한 플라스틱 적층 | 딸기에 대한 Punnets, 플라스틱, ...
- Faridabad
- 인도
supplyautonomy.com/riddhipharmamachinery.in
Manufacturers and Exporters of Pharmaceutical Machineries. Our multitude of products include Pharmaceutical Machinery, Tablet Press Machine, Rotary Tablet Press Machine, Fluid Bed Dryer, Tray drier,... 자세히보기 »
- 식품 산업 플랜트 및 장비 NES | 압출기, 제약 및 화장품 산업 | 석유 가공 공장, 제약 및 화장품 산업 | 제약 및 화장품 분말 장비를 압축 | 혼합 및 혼합 기계, 제약 및 화장품 산업 | 결합 된 낟알 및...
- Mumbai
- 인도
supplyautonomy.com/acmemachineryindiapvt.in
Acme Machinery (India) Pvt. Ltd. is a professionally managed organization accredited for manufacturing and exporting of Paper Board Printing, Packaging and Converting Machineries since... 자세히보기 »
- 골판지 기계를 만드는, 연속, 실린더 | 형, 실린더, 판지 만들기 | 캘린더 기계, 종이 및 판지 만들기 | 마분지 변환 기계, 자동 절단 | 골판지 및 마분지를위한 원형 절단기 | 판지 제조 장비 | 보드 제조 ...
- Mumbai
- 인도
supplyautonomy.com/gdspa.it
G.D is the world's leading cigarette production and packaging machinery constructor. Its vast array of solutions makes G.D. the only company in a position to offer complete high-speed lines.
- 모이스처 라이저, 신발 제조 | 잘라 담배를위한 냉각 설비 | 콘덴서, 소화가 안되기 팻 생산 | 전체 담배 만드는 공장, | 컷 담배에 대한 건조 공장 및 장비 | 컷 담배에 대한 공급 장비, 공압, | 담배 기계...
- Bologna
- 이탈리아
supplyautonomy.com/reconmachinetoolspvt.in
Recon is a leading manufacturer of Plant and Machinery for Metal Cans, Metal Closures Steel Drums, also complete packaging lines for powder, liquid paste in metal containers.
Established in the... 자세히보기 »
- 복합 기계를 만드는 수 | 전달 시스템 수와 뚜껑 수 있습니다 | 수와 통 청소 및 세척 기계 | 기계를 건조 할 수 | 기계를 충전 할 수 있습니다 | 기계를 리딩 할 수 있습니다 | 뚜껑 바다 표범 어업 기계 할...
- Mumbai
- 인도
supplyautonomy.com/assopackmachines.in
We have created a niche among quality-oriented corrugators. Our name inspires confidence not only among Indian corrugators but it is known for its reliability of its products in foreign markets... 자세히보기 »
- , 낚시 감기 및 되감기 기계, 제지 | 감기, 되감기 및 절단 기계, 다중 운영, 제지 | 척, 안전 및 슬라이딩, 용지 감기 및 기계 풀기 | 캘린더 기계, 제지 | 글라 신지, 제지는 기계, 캘린더 | 캘린더 ...
- Ahmedabad
- 인도
supplyautonomy.com/gangasinghengineeringpvt.in
ESSGEE Exports is a proprietary concern established in 1993 and are very strong in exporting machinery which are mainly used in tin container industry, packaging industries and having vast knowledge... 자세히보기 »
- 건설사 도구 | 식품 산업 플랜트 및 장비 NES | 잘 드릴링 기계 | 기타 섬유 기계 | 와이어 드로잉 및 와이어로드 작업 기계 | 밀링 금속 용 기계 | 용접 장비 | 복합 기계를 만드는 수 | 전달 시스템 수...
- Mumbai
- 인도
supplyautonomy.com/apsaraengineers.in
We the manufacturers and exporters of all kinds of textile related machinery, we are specialist in polyfill opening machinery, pillow packing machinery and blowfill machines in nominal cost.
We... 자세히보기 »
- 섬유 기계 용 스풀, 보빈, 콘, 플라스틱, | 회전 튜브, 플라스틱 | 회전 기계에 대한 카드 그림 캔, 플라스틱, | 섬유 기계에 대한 코드, 플라스틱, | 링 스핀들 및 직물 롤러 테이프, 플라스틱, | 스핀들...
- Coimbatore
- 인도
supplyautonomy.com/foshancitycoretamppackingmachineryco.cn
Foshan Coretamp Packaging Machinery Co.,Ltd. is located in China Machinery Center - Foshan city, takes 30 minutes to Guangzhou and 2 hours to Shenzhen/Hong Kong. We are a leading manufacturer of all k... 자세히보기 »
- 포장 기계
- Foshan
- 중국
supplyautonomy.com/excellpacks.in
Welcome
Empowering people through prosperity and helping them create wealth have been the mission of VK Engineering & Company since 2000
VK Engineering & Company and heir... 자세히보기 »
- 포장 및 포장 - 기계 및 장비 | 포장 기계 및 장비 | 포장 기계 | 기계 부품 포장 | 포장 기계
- Coimbatore, Tamil Nādu
- 인도
supplyautonomy.com/cooltechenterprises.in
A renowned name in the domain of Cooling Pads, ABS Ductable Cooling Machine, Desert/Room Coolers, etc., Cool Tech Enterprises has been offering quality to the clients. Combining technology and wide... 자세히보기 »
- 보안 제품 대리점 | 전송 인쇄 | 사출 성형 서비스, 금속 | 절연 재료 | 사용자 정의 디자인 온천 | 커플 링 | 파이프 | 파이프 피팅 | 파이프 및 피팅 | 파이프 및 튜브, 주철...
- Amravati
- 인도
supplyautonomy.com/chamundaindustries.in
We are pleased to introduce ourselves as one of the leading Exporters, Manufacturers , Stockists Supplier of stainless steel item,ferrous non-ferrous metal which are required by your company in... 자세히보기 »
- 보안 제품 대리점 | 전송 인쇄 | 사출 성형 서비스, 금속 | 절연 재료 | 사용자 정의 디자인 온천 | 커플 링 | 파이프 | 파이프 피팅 | 파이프 및 피팅 | 파이프 및 튜브, 주철...
- Mumbai
- 인도
supplyautonomy.com/preciousmineralprocessingsystemspvt.in
CHITRA PHARMA MACHINERY
PRECIOUS FAB-CAST PVT. LTD. , the parent company of CHITRA PHARMA MACHINERY-an ISO 9001: 2000 company is the designer, developer, manufacturer and exporter of various... 자세히보기 »
- 세척 장비 | 식품 산업 플랜트 및 장비 NES | 잘 드릴링 기계 | 밀링 금속 용 기계 | 포장 기계 | 강철 주물, 탄소 | 강철 주물, 크롬 - 니켈 | 강철 주물, 크롬 몰리브덴 | 강철 주물, 페라이트 |...
- Ahmedabad
- 인도
supplyautonomy.com/kusodalamuthucopvt.in
Bharath Paper Conversions are manufacturers and exporters of high quality Paper Cones, Paper Tubes, Paper Cores, Edge Protectors, Composite Cans and Pulp Moulded Products. Established in 1984, the... 자세히보기 »
- 쟁반, 섬유판 | 튜브, 종이 또는 섬유판 | 튜브, 종이 또는 섬유판, 상처 | 튜브, 섬유판가 줄 지어 | 튜브, strawboard 및 마분지 | 튜브, 피치 섬유 | 튜브, 두꺼운 종이, 플라스틱 코팅 | 튜...
- Coimbatore
- 인도
supplyautonomy.com/seniorprintpackmachineryco.in
Manufacturers & Exporters Of Corrugated Board, Box Making Machinery, Corrugated Board Making Plant, Die Punching, Cutting, Creasing & Embossing Machine, Hot Foil Stamping Die Cutting... 자세히보기 »
- 가방 기계 만들기 | 인쇄 및 그래픽 장비 | 용지 정렬 기계 및 장비 | 레이아웃 시스템 (layboys), 종이 변환 | 시트 계산 기계, 종이 변환 | 종이 시트 및 판 계산 및 탭을 삽입 기계 | 종이 묶음 ...
- Hyderabad
- 인도