Mga Resulta ng Paghahanap para sa: Pag-print at graphics equipment

Nahanap 277 kumpanya


supplyautonomy.com/ruianwanyuanpackingmachineco.cn
We are a manufacturer of non woven bag-making machines with well-equipped testing equipment and strong technical force. With a wide range, good quality, reasonable prices and stylish designs, our... Basahin Higit pang mga »
  • Bag paggawa ng makinarya | Pag-print at graphics equipment
  • Ruian
  • China
supplyautonomy.com/ruianweiguoprintingpackagingmachineryfactory.cn
Wenzhou Qiangtuo Machinery Co., Ltd. (Ruian Weiguo Machinery Pakage Factory) is a professional manufacturer of printing machines, film-blowing machines, bag-making machines, slitting machines and... Basahin Higit pang mga »
  • Pag-print at graphics equipment | Iba pang mga materyal handling equipment
  • Wenzhou
  • China
supplyautonomy.com/acmemachinerycompanypvt.in
Into Manufacturing of Paper Corrugated Carton Production Line, print finishing machines since last three decades with excellent customer base using range of our machine. The state of art... Basahin Higit pang mga »
  • Pag-print at graphics equipment | Packaging makinarya
  • Mumbai
  • India
supplyautonomy.com/siadgroupsrl.it
SIAD GROUP srl provides end to end solutions for the new business of printing. We provide services and products including consulting, workflow and finishing printing equipment to match the... Basahin Higit pang mga »
  • Hot Foil panlililak | Pag-print at graphics equipment
  • Arese
  • Italya
supplyautonomy.com/ishaninternational.in
we leading manufacturer of plastic printing machine and bag making machines viz., Rotogravure Printing Machine, Flexo Printing Machine, Bag making machine, side sealing machine, Slitting... Basahin Higit pang mga »
  • Bag paggawa ng makinarya | Pag-print at graphics equipment
  • Ahmedabad
  • India
supplyautonomy.com/junsheng.cn
Our company is located in Dongguang County, Hebei Province, China. We are specialized in manufacturing all kinds of water base ink printing slotting die-cutting machines and whole sets of carton... Basahin Higit pang mga »
  • Nililinis ang mga kagamitan | Pag-print at graphics equipment | Packaging makinarya | Pandiwang pantulong packaging...
  • Cangzhou
  • China
supplyautonomy.com/zhejiangtianfengplasticmachineryplant.cn
Zhejiang Tianfeng Plastic Machinery Plant is a global supplier of standard and custom-engineered products and systems. Our products serve the complete range of PP/PE woven bag machine, leno mesh bag... Basahin Higit pang mga »
  • Bag paggawa ng makinarya | Pag-print at graphics equipment
  • Wenzhou
  • China
supplyautonomy.com/vishvaeximpvt.in
Manufacturer and Exporters of Roto Gravure Printing Machine, Flexo Graph Printing Machine, Laminators (Solvent less), Laminators (Base), Extrusion Machines, Small Packaging Machinery, Core Cutting... Basahin Higit pang mga »
  • Shafts | teleks equipment | Pag-print at graphics equipment | Packaging makinarya
  • Ahmedabad
  • India
supplyautonomy.com/shanghaipripackmachineryco.cn
Shanghai Pripack Machinery Co., Ltd. is a company that specializes in providing printing & packaging machinery and production line. Owning experienced employees and cooperating with many... Basahin Higit pang mga »
  • aluminyo alloys | Pag-print at graphics equipment | Packaging makinarya
  • Shanghai
  • China
supplyautonomy.com/bajajprintpackmachineriespvt.in
We supply hologram Machinery to produce holograms from hologram master shooting to die-cutting, includes hologram master shooting system (2D / 3D master and Dot-matrix master) , recombination... Basahin Higit pang mga »
  • Iba pang mga damit makinarya | Pag-print at graphics equipment | Packaging makinarya
  • New Delhi
  • India
supplyautonomy.com/mmmauenhandelsgesellschaftmbh.de
MMM established in 1986 are specialists in matches industry. Combination of integrity, high business ethics with sound consulatation, makes us your number one souce in Match Machinery and Material... Basahin Higit pang mga »
  • Pag-print at graphics equipment | Iba pang ginamit makinarya | Tabako at naninigarilyo item
  • Hamburg
  • Germany
supplyautonomy.com/natrajcorrugatingmachinerycompany.in
India's leading manufacturer and exporter of paper corrugated board and box making machinery since1955,Brand SUPER NATARAJA FORMERLY KNOWN AS NATARAJA. company have the experience of making... Basahin Higit pang mga »
  • Pag-print at graphics equipment | Iba pang mga materyal handling equipment | Packaging makinarya
  • New Delhi
  • India
supplyautonomy.com/seniormachineryco.in
About Us Promoted by a Team of qualified professionals. Highly experienced in the machinery filed. We are 25 years old, out of which 15 years we were manufacturing Printing related... Basahin Higit pang mga »
  • Pag-print at graphics equipment | Papel processing machinery bahagi | Packaging makinarya
  • Pune
  • India
supplyautonomy.com/alphagraphics737.us
At Alphagraphics 737 Grapevine, TX we have the skills and tools to help brand your company effectively. Call us for printing services, blueprint, car wraps, signs and banners.
  • Graphics workstation | Pag-print at graphics equipment | Blueprint-pagkopya makinarya | Mga Printer & binders
  • Grapevine
  • Estados Unidos
supplyautonomy.com/webcoindustries.in
  • Pag-print at graphics equipment | Offset printer
  • Faridabad
  • India
supplyautonomy.com/lapraco.in
For more than 38 years, Lapra Co. has been constantly demonstrating its innovative power and is today one of the leading companies in the area of flexible packaging Our passion for ... Basahin Higit pang mga »
  • Pag-print at graphics equipment | Rotograbado pagpi-print machine
  • New Delhi
  • India
supplyautonomy.com/multipresssrl.it
  • Stamping, plastik - makinarya | Pag-iiniksyon, plastik - makinarya | Plastic - pang-industriya makinarya at kagamitan |...
  • Ponte San Marco
  • Italya
supplyautonomy.com/urstechnologyofindia.in
Breaking new grounds in the domain of printers and allied machines, we, URS Technology Of India, have captured a huge market share. Our products are of high quality and meet the industrial quality... Basahin Higit pang mga »
  • Pag-print at graphics equipment | Pag-print ng tinta at pintura raw na materyal
  • Kolkata
  • India
supplyautonomy.com/suntrading.in
  • Mga Bag | Wallets | Pag-print at graphics equipment | Offset printer | Non habi tela
  • Chennai
  • India
supplyautonomy.com/kptechmachineindiapvt.in
  • Tela | Mga Bag | Wallets | Pag-print at graphics equipment | hinang kagamitan | Non habi tela
  • Ahmedabad
  • India
supplyautonomy.com/hicmachineryco.in
  • Electronic supplies | Pag-print at graphics equipment | Packaging makinarya | Mga Printer & binders
  • Amritsar
  • India
supplyautonomy.com/chinacangzhoujiajiamachinerymanufacture.cn
  • Builders 'tool | Motor sasakyan electrical at electronic na kagamitan | Pag-print at graphics equipment | Mandrels at...
  • Cangzhou
  • China
supplyautonomy.com/babrahindustrialcorporation.in
About Babrah Industrial CorporationWe, Babrah Industrial Corporation, are meeting the bulk and urgent orders of our valued clients via our robust production facilities, supported distribution network... Basahin Higit pang mga »
  • Pag-print at graphics equipment
  • Amritsar
  • India
supplyautonomy.com/carmelengineering.in
We are manufacturer, supplier and exporter of flexo printing machinery such as flexographic printing machine and apart from this we also deals into non woven printing machine, lamination machine,... Basahin Higit pang mga »
  • Pag-print at graphics equipment
  • Madurai
  • India
supplyautonomy.com/universalinksvarnishplimited.in
In the field of Inks & Varnish, we 'Universal Inks & Varnish (P) Ltd.' are leading the market since 1981 as a renowned manufacturer, exporter, importer and supplier. Our company has... Basahin Higit pang mga »
  • Pag-print at graphics equipment | Mga nakalimbag at mga kaugnay na mga produkto | Pag-print ng tinta at pintura raw na...
  • Delhi
  • India
supplyautonomy.com/ramanindustries.in
In the year of 1971 the company was established and engaged itself as a paper converterand susequently in the year of 1973 it had started Machine manufacturing unit. Now-a-days it has covered area... Basahin Higit pang mga »
  • Plastic laminating makinarya | Pag-print at graphics equipment
  • Kolkata
  • India
supplyautonomy.com/msenterprises20.in
To offer a comprehensive product line meeting the engineering needs of our clients, M.S. Enterprises was established in the year 1975. We are renowned in the industry as leading Manufacturer,... Basahin Higit pang mga »
  • Pag-print at graphics equipment
  • Faridabad
  • India
supplyautonomy.com/asindustrialconsultingservices.in
Catering a range of integrated technical consultancy services to a varied range of industrial houses for setting up new projects in India or abroad...A.S. Industrial Consulting Services, thereafter... Basahin Higit pang mga »
  • Pag-print at graphics equipment
  • Gurgaon
  • India
supplyautonomy.com/ruiancambridgemachinery.cn
Located in RUIAN, the well-known Soft Package City of China, Ruian CAMBRIDGE MACHINE I/E Company pours big energy in package machinery. In 2008, we got the foot in manufacturing of Plastic Film... Basahin Higit pang mga »
  • Bag paggawa ng makinarya | Pag-print at graphics equipment
  • Ruian
  • China
supplyautonomy.com/marsonsprintgrafmachinespvt.in
  • Pandikit at tape | Pag-print at graphics equipment | Rotograbado pagpi-print machine | Packaging makinarya | Panlililak...
  • Mumbai
  • India