Loading...
ძებნის შედეგები: ბეჭდვა და გრაფიკული აღჭურვილობა
ნაპოვნია 277 კომპანიებიsupplyautonomy.com/ruianwanyuanpackingmachineco.cn
We are a manufacturer of non woven bag-making machines with well-equipped testing equipment and strong technical force. With a wide range, good quality, reasonable prices and stylish designs, our... დაწვრილებით »
- ჩანთა მიღების მანქანა | ბეჭდვა და გრაფიკული აღჭურვილობა...
- Ruian
- ჩინეთი
supplyautonomy.com/ruianweiguoprintingpackagingmachineryfactory.cn
Wenzhou Qiangtuo Machinery Co., Ltd. (Ruian Weiguo Machinery Pakage Factory) is a professional manufacturer of printing machines, film-blowing machines, bag-making machines, slitting machines and... დაწვრილებით »
- ბეჭდვა და გრაფიკული აღჭურვილობა | სხვა მატერიალური გატარება აღჭურვილობა...
- Wenzhou
- ჩინეთი
supplyautonomy.com/acmemachinerycompanypvt.in
Into Manufacturing of Paper Corrugated Carton Production Line, print finishing machines since last three decades with excellent customer base using range of our machine.
The state of art... დაწვრილებით »
- ბეჭდვა და გრაფიკული აღჭურვილობა | შეფუთვის მანქანები...
- Mumbai
- ინდოეთი
supplyautonomy.com/siadgroupsrl.it
SIAD GROUP srl provides end to end solutions for the new business of printing. We provide services and products including consulting, workflow and finishing printing equipment to match the... დაწვრილებით »
- ცხელი ჭედურობა კილიტა | ბეჭდვა და გრაფიკული აღჭურვილობა...
- Arese
- იტალია
supplyautonomy.com/ishaninternational.in
we leading manufacturer of plastic printing machine and bag making machines viz., Rotogravure Printing Machine, Flexo Printing Machine, Bag making machine, side sealing machine, Slitting... დაწვრილებით »
- ჩანთა მიღების მანქანა | ბეჭდვა და გრაფიკული აღჭურვილობა...
- Ahmedabad
- ინდოეთი
supplyautonomy.com/junsheng.cn
Our company is located in Dongguang County, Hebei Province, China. We are specialized in manufacturing all kinds of water base ink printing slotting die-cutting machines and whole sets of carton... დაწვრილებით »
- დასუფთავების აღჭურვილობა | ბეჭდვა და გრაფიკული აღჭურვილობა | შეფუთვის მანქანები | დამხმარე შესაფუთი მოწყობილობები...
- Cangzhou
- ჩინეთი
supplyautonomy.com/zhejiangtianfengplasticmachineryplant.cn
Zhejiang Tianfeng Plastic Machinery Plant is a global supplier of standard and custom-engineered products and systems. Our products serve the complete range of PP/PE woven bag machine, leno mesh bag... დაწვრილებით »
- ჩანთა მიღების მანქანა | ბეჭდვა და გრაფიკული აღჭურვილობა...
- Wenzhou
- ჩინეთი
supplyautonomy.com/vishvaeximpvt.in
Manufacturer and Exporters of Roto Gravure Printing Machine, Flexo Graph Printing Machine, Laminators (Solvent less), Laminators (Base), Extrusion Machines, Small Packaging Machinery, Core Cutting... დაწვრილებით »
- ლილვები | ტელექსი აღჭურვილობა | ბეჭდვა და გრაფიკული აღჭურვილობა | შეფუთვის მანქანები...
- Ahmedabad
- ინდოეთი
supplyautonomy.com/shanghaipripackmachineryco.cn
Shanghai Pripack Machinery Co., Ltd. is a company that specializes in providing printing & packaging machinery and production line. Owning experienced employees and cooperating with many... დაწვრილებით »
- ალუმინის შენადნობები | ბეჭდვა და გრაფიკული აღჭურვილობა | შეფუთვის მანქანები...
- Shanghai
- ჩინეთი
supplyautonomy.com/bajajprintpackmachineriespvt.in
We supply hologram Machinery to produce holograms from hologram master shooting to die-cutting, includes hologram master shooting system (2D / 3D master and Dot-matrix master) , recombination... დაწვრილებით »
- სხვა ტანსაცმელი მანქანა | ბეჭდვა და გრაფიკული აღჭურვილობა | შეფუთვის მანქანები...
- New Delhi
- ინდოეთი
supplyautonomy.com/mmmauenhandelsgesellschaftmbh.de
MMM established in 1986 are specialists in matches industry.
Combination of integrity, high business ethics with sound consulatation, makes us your number one souce in Match Machinery and Material... დაწვრილებით »
- ბეჭდვა და გრაფიკული აღჭურვილობა | სხვა მეორადი მანქანები | თამბაქოს და მწეველთა ნივთები...
- Hamburg
- გერმანია
supplyautonomy.com/natrajcorrugatingmachinerycompany.in
India's leading manufacturer and exporter of paper corrugated board and box making machinery since1955,Brand SUPER NATARAJA FORMERLY KNOWN AS NATARAJA. company have the experience of making... დაწვრილებით »
- ბეჭდვა და გრაფიკული აღჭურვილობა | სხვა მატერიალური გატარება აღჭურვილობა | შეფუთვის მანქანები...
- New Delhi
- ინდოეთი
supplyautonomy.com/seniormachineryco.in
About Us
Promoted by a Team of qualified professionals. Highly experienced in the machinery filed.
We are 25 years old, out of which 15 years we were manufacturing Printing related... დაწვრილებით »
- ბეჭდვა და გრაფიკული აღჭურვილობა | ქაღალდის გადამამუშავებელი დანადგარები ნაწილები | შეფუთვის მანქანები...
- Pune
- ინდოეთი
supplyautonomy.com/alphagraphics737.us
At Alphagraphics 737 Grapevine, TX we have the skills and tools to help brand your company effectively. Call us for printing services, blueprint, car wraps, signs and banners.
- გრაფიკული სამუშაო სადგურები | ბეჭდვა და გრაფიკული აღჭურვილობა | გეგმა-გადაწერა მანქანა | პრინტერი და ბაინდერები...
- Grapevine
- ამერიკის შეერთებული შტატები
supplyautonomy.com/webcoindustries.in
supplyautonomy.com/lapraco.in
For more than 38 years, Lapra Co. has been constantly demonstrating its innovative
power and is today one of the leading companies in the area of flexible packaging
Our passion for ... დაწვრილებით »
- ბეჭდვა და გრაფიკული აღჭურვილობა | Rotogravure საბეჭდი მანქანა...
- New Delhi
- ინდოეთი
supplyautonomy.com/multipresssrl.it
- ჭედურობა, პლასტმასის - დანადგარები | ინჟექტორი, პლასტმასის - დანადგარები | პლასტმასი - სამრეწველო მანქანები და მოწყობილო...
- Ponte San Marco
- იტალია
supplyautonomy.com/urstechnologyofindia.in
Breaking new grounds in the domain of printers and allied machines, we, URS Technology Of India, have captured a huge market share. Our products are of high quality and meet the industrial quality... დაწვრილებით »
- ბეჭდვა და გრაფიკული აღჭურვილობა | ბეჭდვის მელნის და საღებავი ნედლეულის...
- Kolkata
- ინდოეთი
supplyautonomy.com/suntrading.in
supplyautonomy.com/kptechmachineindiapvt.in
- ნაწარმი | ჩანთები | ჩანთები | ბეჭდვა და გრაფიკული აღჭურვილობა | შედუღების მოწყობილობები | არასასოფლო ქსოვილებისა...
- Ahmedabad
- ინდოეთი
supplyautonomy.com/hicmachineryco.in
- ელექტრონული წყაროები | ბეჭდვა და გრაფიკული აღჭურვილობა | შეფუთვის მანქანები | პრინტერი და ბაინდერები...
- Amritsar
- ინდოეთი
supplyautonomy.com/chinacangzhoujiajiamachinerymanufacture.cn
- მშენებელთა ინსტრუმენტები | ავტომობილების ელექტრო და ელექტრონული მოწყობილობები | ბეჭდვა და გრაფიკული აღჭურვილობა | Mandre...
- Cangzhou
- ჩინეთი
supplyautonomy.com/babrahindustrialcorporation.in
About Babrah Industrial CorporationWe, Babrah Industrial Corporation, are meeting the bulk and urgent orders of our valued clients via our robust production facilities, supported distribution network... დაწვრილებით »
- ბეჭდვა და გრაფიკული აღჭურვილობა
- Amritsar
- ინდოეთი
supplyautonomy.com/carmelengineering.in
We are manufacturer, supplier and exporter of flexo printing machinery such as flexographic printing machine and apart from this we also deals into non woven printing machine, lamination machine,... დაწვრილებით »
- ბეჭდვა და გრაფიკული აღჭურვილობა
- Madurai
- ინდოეთი
supplyautonomy.com/universalinksvarnishplimited.in
In the field of Inks & Varnish, we 'Universal Inks & Varnish (P) Ltd.' are leading the market since 1981 as a renowned manufacturer, exporter, importer and supplier. Our company has... დაწვრილებით »
- ბეჭდვა და გრაფიკული აღჭურვილობა | ნაბეჭდი მასალა და მონათესავე პროდუქცია | ბეჭდვის მელნის და საღებავი ნედლეულის...
- Delhi
- ინდოეთი
supplyautonomy.com/ramanindustries.in
In the year of 1971 the company was established and engaged itself as a paper converterand susequently in the year of 1973 it had started Machine manufacturing unit. Now-a-days it has covered area... დაწვრილებით »
- პლასტიკური ლამინირება მანქანა | ბეჭდვა და გრაფიკული აღჭურვილობა...
- Kolkata
- ინდოეთი
supplyautonomy.com/msenterprises20.in
To offer a comprehensive product line meeting the engineering needs of our clients, M.S. Enterprises was established in the year 1975. We are renowned in the industry as leading Manufacturer,... დაწვრილებით »
- ბეჭდვა და გრაფიკული აღჭურვილობა
- Faridabad
- ინდოეთი
supplyautonomy.com/asindustrialconsultingservices.in
Catering a range of integrated technical consultancy services to a varied range of industrial houses for setting up new projects in India or abroad...A.S. Industrial Consulting Services, thereafter... დაწვრილებით »
- ბეჭდვა და გრაფიკული აღჭურვილობა
- Gurgaon
- ინდოეთი
supplyautonomy.com/ruiancambridgemachinery.cn
Located in RUIAN, the well-known Soft Package City of China, Ruian CAMBRIDGE MACHINE I/E Company pours big energy in package machinery. In 2008, we got the foot in manufacturing of Plastic Film... დაწვრილებით »
- ჩანთა მიღების მანქანა | ბეჭდვა და გრაფიკული აღჭურვილობა...
- Ruian
- ჩინეთი
supplyautonomy.com/marsonsprintgrafmachinespvt.in
- ადჰეზივები და ფირზე | ბეჭდვა და გრაფიკული აღჭურვილობა | Rotogravure საბეჭდი მანქანა | შეფუთვის მანქანები | კილიტა სატვიფ...
- Mumbai
- ინდოეთი