Matokeo ya: Uchapishaji na graphics vifaa
Kupatikana 277 makampunisupplyautonomy.com/ruianwanyuanpackingmachineco.cn
We are a manufacturer of non woven bag-making machines with well-equipped testing equipment and strong technical force. With a wide range, good quality, reasonable prices and stylish designs, our... Soma Zaidi »
- Mfuko kufanya mashine | Uchapishaji na graphics vifaa
- Ruian
- China
supplyautonomy.com/ruianweiguoprintingpackagingmachineryfactory.cn
Wenzhou Qiangtuo Machinery Co., Ltd. (Ruian Weiguo Machinery Pakage Factory) is a professional manufacturer of printing machines, film-blowing machines, bag-making machines, slitting machines and... Soma Zaidi »
- Uchapishaji na graphics vifaa | Nyingine nyenzo utunzaji vifaa
- Wenzhou
- China
supplyautonomy.com/acmemachinerycompanypvt.in
Into Manufacturing of Paper Corrugated Carton Production Line, print finishing machines since last three decades with excellent customer base using range of our machine.
The state of art... Soma Zaidi »
- Uchapishaji na graphics vifaa | Ufungaji mitambo ya
- Mumbai
- India
supplyautonomy.com/siadgroupsrl.it
SIAD GROUP srl provides end to end solutions for the new business of printing. We provide services and products including consulting, workflow and finishing printing equipment to match the... Soma Zaidi »
- Moto stamping foil | Uchapishaji na graphics vifaa
- Arese
- Italia
supplyautonomy.com/ishaninternational.in
we leading manufacturer of plastic printing machine and bag making machines viz., Rotogravure Printing Machine, Flexo Printing Machine, Bag making machine, side sealing machine, Slitting... Soma Zaidi »
- Mfuko kufanya mashine | Uchapishaji na graphics vifaa
- Ahmedabad
- India
supplyautonomy.com/junsheng.cn
Our company is located in Dongguang County, Hebei Province, China. We are specialized in manufacturing all kinds of water base ink printing slotting die-cutting machines and whole sets of carton... Soma Zaidi »
- Kusafisha vifaa | Uchapishaji na graphics vifaa | Ufungaji mitambo ya | Msaidizi ufungaji vifaa
- Cangzhou
- China
supplyautonomy.com/zhejiangtianfengplasticmachineryplant.cn
Zhejiang Tianfeng Plastic Machinery Plant is a global supplier of standard and custom-engineered products and systems. Our products serve the complete range of PP/PE woven bag machine, leno mesh bag... Soma Zaidi »
- Mfuko kufanya mashine | Uchapishaji na graphics vifaa
- Wenzhou
- China
supplyautonomy.com/vishvaeximpvt.in
Manufacturer and Exporters of Roto Gravure Printing Machine, Flexo Graph Printing Machine, Laminators (Solvent less), Laminators (Base), Extrusion Machines, Small Packaging Machinery, Core Cutting... Soma Zaidi »
- machimbo ya | Telex vifaa | Uchapishaji na graphics vifaa | Ufungaji mitambo ya
- Ahmedabad
- India
supplyautonomy.com/shanghaipripackmachineryco.cn
Shanghai Pripack Machinery Co., Ltd. is a company that specializes in providing printing & packaging machinery and production line. Owning experienced employees and cooperating with many... Soma Zaidi »
- Aluminium aloi | Uchapishaji na graphics vifaa | Ufungaji mitambo ya
- Shanghai
- China
supplyautonomy.com/bajajprintpackmachineriespvt.in
We supply hologram Machinery to produce holograms from hologram master shooting to die-cutting, includes hologram master shooting system (2D / 3D master and Dot-matrix master) , recombination... Soma Zaidi »
- Nyingine nguo mashine | Uchapishaji na graphics vifaa | Ufungaji mitambo ya
- New Delhi
- India
supplyautonomy.com/mmmauenhandelsgesellschaftmbh.de
MMM established in 1986 are specialists in matches industry.
Combination of integrity, high business ethics with sound consulatation, makes us your number one souce in Match Machinery and Material... Soma Zaidi »
- Uchapishaji na graphics vifaa | Nyingine kutumika mashine | Tumbaku na wavuta vitu
- Hamburg
- Ujerumani
supplyautonomy.com/natrajcorrugatingmachinerycompany.in
India's leading manufacturer and exporter of paper corrugated board and box making machinery since1955,Brand SUPER NATARAJA FORMERLY KNOWN AS NATARAJA. company have the experience of making... Soma Zaidi »
- Uchapishaji na graphics vifaa | Nyingine nyenzo utunzaji vifaa | Ufungaji mitambo ya
- New Delhi
- India
supplyautonomy.com/seniormachineryco.in
About Us
Promoted by a Team of qualified professionals. Highly experienced in the machinery filed.
We are 25 years old, out of which 15 years we were manufacturing Printing related... Soma Zaidi »
- Uchapishaji na graphics vifaa | Karatasi usindikaji mashine sehemu | Ufungaji mitambo ya
- Pune
- India
supplyautonomy.com/alphagraphics737.us
At Alphagraphics 737 Grapevine, TX we have the skills and tools to help brand your company effectively. Call us for printing services, blueprint, car wraps, signs and banners.
- Graphics vituo | Uchapishaji na graphics vifaa | Mwongozo-kuiga mashine | Printers & binders
- Grapevine
- Marekani
supplyautonomy.com/webcoindustries.in
supplyautonomy.com/lapraco.in
For more than 38 years, Lapra Co. has been constantly demonstrating its innovative
power and is today one of the leading companies in the area of flexible packaging
Our passion for ... Soma Zaidi »
- Uchapishaji na graphics vifaa | Rotogravure uchapishaji mashine
- New Delhi
- India
supplyautonomy.com/multipresssrl.it
- Stamping, plastiki - mashine | Sindano, plastiki - mashine | Plastiki - viwanda mitambo na vifaa | Uchapishaji na...
- Ponte San Marco
- Italia
supplyautonomy.com/urstechnologyofindia.in
Breaking new grounds in the domain of printers and allied machines, we, URS Technology Of India, have captured a huge market share. Our products are of high quality and meet the industrial quality... Soma Zaidi »
- Uchapishaji na graphics vifaa | Uchapishaji wino & rangi malighafi
- Kolkata
- India
supplyautonomy.com/suntrading.in
supplyautonomy.com/kptechmachineindiapvt.in
- Vitambaa | Mifuko ya | Pochi | Uchapishaji na graphics vifaa | Vifaa vya kulehemu | Yasiyo ya kusuka kitambaa
- Ahmedabad
- India
supplyautonomy.com/hicmachineryco.in
- Elektroniki vifaa | Uchapishaji na graphics vifaa | Ufungaji mitambo ya | Printers & binders
- Amritsar
- India
supplyautonomy.com/chinacangzhoujiajiamachinerymanufacture.cn
- Wajenzi 'zana | Magari ya umeme na vifaa vya umeme | Uchapishaji na graphics vifaa | Mandrels na tailstocks
- Cangzhou
- China
supplyautonomy.com/babrahindustrialcorporation.in
About Babrah Industrial CorporationWe, Babrah Industrial Corporation, are meeting the bulk and urgent orders of our valued clients via our robust production facilities, supported distribution network... Soma Zaidi »
- Uchapishaji na graphics vifaa
- Amritsar
- India
supplyautonomy.com/carmelengineering.in
We are manufacturer, supplier and exporter of flexo printing machinery such as flexographic printing machine and apart from this we also deals into non woven printing machine, lamination machine,... Soma Zaidi »
- Uchapishaji na graphics vifaa
- Madurai
- India
supplyautonomy.com/universalinksvarnishplimited.in
In the field of Inks & Varnish, we 'Universal Inks & Varnish (P) Ltd.' are leading the market since 1981 as a renowned manufacturer, exporter, importer and supplier. Our company has... Soma Zaidi »
- Uchapishaji na graphics vifaa | Printed jambo na kuhusiana na bidhaa | Uchapishaji wino & rangi malighafi
- Delhi
- India
supplyautonomy.com/ramanindustries.in
In the year of 1971 the company was established and engaged itself as a paper converterand susequently in the year of 1973 it had started Machine manufacturing unit. Now-a-days it has covered area... Soma Zaidi »
- Plastiki laminating mashine | Uchapishaji na graphics vifaa
- Kolkata
- India
supplyautonomy.com/msenterprises20.in
To offer a comprehensive product line meeting the engineering needs of our clients, M.S. Enterprises was established in the year 1975. We are renowned in the industry as leading Manufacturer,... Soma Zaidi »
- Uchapishaji na graphics vifaa
- Faridabad
- India
supplyautonomy.com/asindustrialconsultingservices.in
Catering a range of integrated technical consultancy services to a varied range of industrial houses for setting up new projects in India or abroad...A.S. Industrial Consulting Services, thereafter... Soma Zaidi »
- Uchapishaji na graphics vifaa
- Gurgaon
- India
supplyautonomy.com/ruiancambridgemachinery.cn
Located in RUIAN, the well-known Soft Package City of China, Ruian CAMBRIDGE MACHINE I/E Company pours big energy in package machinery. In 2008, we got the foot in manufacturing of Plastic Film... Soma Zaidi »
- Mfuko kufanya mashine | Uchapishaji na graphics vifaa
- Ruian
- China
supplyautonomy.com/marsonsprintgrafmachinespvt.in
- Lim na mkanda | Uchapishaji na graphics vifaa | Rotogravure uchapishaji mashine | Ufungaji mitambo ya | Stamping foils
- Mumbai
- India